6DZZA

Cryo-em structure of the wild-type human serotonin transporter in complex with ibogaine and 15b8 fab in the inward conformation
Slipknot S 41 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 38-275 238 276-540 1-21 22-37 21 264 slipknot
view details
41 15-304 290 1-14 364-540 305-363 14 177 slipknot
Chain Sequence
ERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 15-297 283 1-14 309-540 298-308 14 232 slipknot
view details
4.1 14-308 295 1-13 354-540 309-353 13 187 slipknot
view details
3.2 17-349 333 1-16 361-540 350-360 16 180 slipknot
view details
3.2 15-360 346 1-14 371-540 361-370 14 170 slipknot
view details
3.2 18-346 329 1-13, 360-540 14-17, 347-359 13 181 slipknot
view details
4.1 18-338 321 1-13, 347-540 14-17, 339-346 13 194 slipknot
view details
2.1 42-367 326 1-19, 401-540 20-41, 368-400 19 140 slipknot
view details
2.1 42-425 384 1-20, 486-540 21-41, 426-485 20 55 slipknot
view details
1.1 40-254 215 1-25, 268-540 26-39, 255-267 25 273 slipknot
view details
1.1 43-286 244 1-30, 304-540 31-42, 287-303 30 237 slipknot
sequence length 540
structure length 540
publication title Cryo-EM structures of human serotonin transporter in complex with ibogaine
rcsb
molecule tags Transport protein/immune system
molecule keywords Sodium-dependent serotonin transporter
source organism Homo sapiens
total genus Genus: 126
ec nomenclature
pdb deposition date 2018-07-05
KnotProt deposition date 2019-05-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.