| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 26-219 | 194 | 1-25, 220-222 | 25 | 2 | slipknot |
Chain Sequence |
HWSYHGETGPQHWGDLKNEYIMCKIGKNQSPVDISRIVEAELEKIKINYSSGGSSITNNGHTIKVSYEPGSYIIVDGIRFELKQFHFHAPSEHTIKGKSYPFEAHFVHADKDGNLAVIGVIFKEGKKNPIIEKIWENLPEAGKTIKLAHKINAYDLLPKKKKYYRYSGSLTTPPCSEGVRWIVMEEEMELSKEQIEKFRKLMGGDTNRPVQPLNARMIMEMD
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 27-201 | 175 | 1-26, 202-205 | 26 | 4 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | His32 ... His117 <-> Bridging ionZn301 <-> His136 ... Chain closureAsp253 <-> His32 |
probabilistic | |||
|
|
K +31 | Chain closureHis32 <-> Asp253 ... His119 <-> Bridging ionZn301 <-> His117 ... His32 |
probabilistic | |||
|
|
K +31 | His32 ... His119 <-> Bridging ionZn301 <-> His136 ... Chain closureAsp253 <-> His32 |
probabilistic |
Chain Sequence |
HWSYHGETGPQHWGDLKNEYIMCKIGKNQSPVDISRIVEAELEKIKINYSSGGSSITNNGHTIKVSYEPGSYIIVDGIRFELKQFHFHAPSEHTIKGKSYPFEAHFVHADKDGNLAVIGVIFKEGKKNPIIEKIWENLPEAGKTIKLAHKINAYDLLPKKKKYYRYSGSLTTPPCSEGVRWIVMEEEMELSKEQIEKFRKLMGGDTNRPVQPLNARMIMEMD
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 28-221 | 194 | 1-27, 222-222 | 27 | 1 | knot | ||||
| view details |
 |
2.1 | 29-217 | 189 | 1-28 | 222-222 | 218-221 | 28 | 1 | slipknot |
| sequence length |
222
|
| structure length |
222
|
| publication title |
Structure of a hyperthermostable carbonic anhydrase identified from an active hydrothermal vent chimney.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase
|
| source organism |
Persephonella marina
|
| total genus |
 Genus: 60
|
| ec nomenclature | |
| pdb deposition date | 2017-09-26 |
| KnotProt deposition date | 2018-10-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
