6G4TA

The crystal structure of uninhibited c183s/c217s mutant of human ca vii
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 24-255 232 1-23, 256-259 23 3 slipknot
Chain Sequence
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 4x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 24-255 232 1-23, 256-259 23 4 knot
Fingerprint Knot forming loop Loop type
K +31 Gly4 ... His94 <->
Bridging ionZn301
<-> His96 ...
Chain closureAla262 <-> Gly4
probabilistic
K +31 Gly4 ... Cys54 <-> Cys178 ...
Chain closureAla262 <-> Gly4
probabilistic
K +31 Gly4 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closureAla262 <-> Gly4
probabilistic
K +31 Gly4 ... His94 <->
Bridging ionZn301
<-> His119 ...
Chain closureAla262 <-> Gly4
probabilistic
Chain Sequence
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 26-256 231 1-25, 257-259 25 3 knot
view details
2.1 24-252 229 1-23 258-259 253-257 23 2 slipknot
publication title The Crystal Structure of a hCA VII Variant Provides Insights into the Molecular Determinants Responsible for Its Catalytic Behavior.
pubmed doi rcsb
structure length 259
molecule tags Lyase
source organism Homo sapiens
sequence length 259
total genus Genus: 73
molecule keywords Carbonic anhydrase 7
ec nomenclature
pdb deposition date 2018-03-28
KnotProt deposition date 2018-10-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling