| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
-31 | 594-693 | 100 | 1-593, 694-748 | 593 | 55 | knot |
Chain Sequence |
ERMIVHRCRFVDFTPATITSLAFSHKSNINKLTPSDLRLAIGRSNGNIEIWNPRNNWFQEMVIEGGKDRSIEGLCWSNVNGESLRLFSIGGSTVVTEWDLATGLPLRNYDCNSGVIWSISINDSQDKLSVGCDNGTVVLIDISGGPGVLEHDTILMRQEARVLTLAWKKDDFVIGGCSDGRIRIWSAQKNDENMGRLLHTMKVDKAKKESTLVWSVIYLPRTDQIASGDSTGSIKFWDFQFATLNQSFKAHDADVLCLTTDTDNNYVFSAGVDRKIFQFSQNTNKSQKNNRWVNSSNRLLHGNDIRAICAYQSKGADFLVSGGVEKTLVINSLTSFSNGNYRKMPTVEPYSKNVLVNKEQRLVVSWSESTVKIWTMG-------NYKLVCKLTLKDDQNISTCSLSPDGQVLVVGRPSTTKVFHLQPVGNKLKVTKLDNDLLLRTSTKLVKFIDNSKIVICSCEDDVFIVDLPQEVELL-------EVTSTKSSIKVPYINRINHLEVDQNIAVISRGCGVVDILDLKARISKPLARLNNFITAVHINTSRKSVVVITADNKIYEFNMNLNSESVLTQWSKNNTDN-------LPKEWKTLKENCVGIFSDIENSSRLWFWGATWISRIDFDVDFPINKXXXXXXXXXXXXXXHFFFTDKYKPLLFVDLISSNELAIIERNPLTFHSKQKAFIQPKLVF
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
|
3.1m | 560-653 | 94 | 1-559, 654-699 | 559 | 46 | knot | |||
| view details |
|
3.1m | 591-653 | 63 | 654-699 | 1-562 | 563-590 | 562 | 45 | slipknot | ||
| view details |
|
3.1m | 594-654 | 61 | 655-699 | 1-590 | 591-593 | 590 | 44 | slipknot | ||
| view details |
|
2.1m | 597-654 | 58 | 655-699 | 1-593 | 594-596 | 593 | 44 | slipknot |
| sequence length |
699
|
| structure length |
678
|
| publication title |
Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
pubmed doi rcsb |
| molecule tags |
Ribosome
|
| molecule keywords |
5'ETS rRNA
|
| missing residues |
378-384, 473-479, 573-579
|
| total genus |
Genus: 37
|
| ec nomenclature | |
| pdb deposition date | 2018-12-13 |
| KnotProt deposition date | 2019-07-29 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...