6RQQA

X-ray crystal structure of protiated (h) large monoclinic unit cell ca ix sv.
Genus: 69
Alphaknot: Q16790
Knot K +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 21-250 230 1-20, 251-256 20 6 knot
Chain Sequence
HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVD
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 21-228 208 1-20, 229-235 20 7 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis140 <-> Asp395
... His251 <->
Bridging ionZn401
<-> His228 ... His140		 probabilistic
K +31
Chain closureHis140 <-> Asp395
... His251 <->
Bridging ionZn401
<-> His226 ... His140		 probabilistic
K +31
Chain closureHis140 <-> Asp395
... His228 <->
Bridging ionZn401
<-> His226 ... His140		 probabilistic
Chain Sequence
HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVD
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 23-250 228 1-22, 251-256 22 6 knot
view details
2.1 21-246 226 1-20 251-256 247-250 20 6 slipknot
sequence length 256
structure length 256
publication title Structural comparison of protiated, H/D-exchanged and deuterated human carbonic anhydrase IX
doi rcsb
molecule tags Proton transport
molecule keywords Carbonic anhydrase 9
source organism Homo sapiens
total genus Genus: 69
ec nomenclature ec 4.2.1.1: Alcohol dehydrogenase.
pdb deposition date 2019-05-16
KnotProt deposition date 2019-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling