6ZR9 | KnotProt

Genus: 75
Alphaknot: P43166

Knot K +3₁

script 1 started

platformSpeed = 8

JSmol exec jmolApplet1 start applet null

Jmol JavaScript applet jmolApplet1__977326570089776__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet1__977326570089776__)

vwrOptions:

{ "name":"jmolApplet1","applet":true,"documentBase":"https://knotprot.cent.uw.edu.pl/view/6zr9/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet1__977326570089776__","codePath":"https:/static/js/j2s/","display":"jmolApplet1_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"977326570089776","bgcolor":"white" }

setting document base to "https://knotprot.cent.uw.edu.pl/view/6zr9/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet1 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet1__977326570089776__ ready

Help Knotting data interpretation Full screen

					Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details				+3₁	22-254	233	1-21, 255-258			21	4	knot

Chain Sequence

WGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K 4x +3₁

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__977326570089776__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__977326570089776__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://knotprot.cent.uw.edu.pl/view/6zr9/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__977326570089776__","codePath":"https:/static/js/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"977326570089776","bgcolor":"white" }

setting document base to "https://knotprot.cent.uw.edu.pl/view/6zr9/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__977326570089776__ ready

script 1 started

platformSpeed = 8

Viewer cachePut cache://localLOAD_/static/knot_data/6zr9/A/6zr9_A.pdb.gz

Viewer cachePut https://knotprot.cent.uw.edu.pl/static/knot_data/6zr9/A/6zr9_A.pdb.gz

FileManager.getAtomSetCollectionFromFile(/static/knot_data/6zr9/A/6zr9_A.pdb.gz)

The Resolver thinks Pdb

loadScript /static/js/j2s/core/corebio.z.js

Time for openFile(/static/knot_data/6zr9/A/6zr9_A.pdb.gz): 1566 ms

reading 258 atoms

ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false

1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them.

Default Van der Waals type for model set to Jmol

258 atoms created

ModelSet: autobonding; use autobond=false to not generate bonds automatically

Time for creating model: 90 ms

Adding embedded #jmolscript: select ({0:257});backbone only;select *;

Viewer cachePut cache://localLOAD_/static/knot_data/6zr9/A/6zr9_A.pdb.gz

Viewer cachePut https://knotprot.cent.uw.edu.pl/static/knot_data/6zr9/A/6zr9_A.pdb.gz

Viewer cachePut cache://localLOAD_/static/knot_data/6zr9/A/6zr9_A.pdb.gz

Viewer cachePut https://knotprot.cent.uw.edu.pl/static/knot_data/6zr9/A/6zr9_A.pdb.gz

FileManager.getAtomSetCollectionFromFile(/static/knot_data/6zr9/A/6zr9_A.pdb.gz)

The Resolver thinks Pdb

Time for openFile(/static/knot_data/6zr9/A/6zr9_A.pdb.gz): 25 ms

reading 258 atoms

ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false

1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them.

Default Van der Waals type for model set to Jmol

258 atoms created

ModelSet: autobonding; use autobond=false to not generate bonds automatically

Time for creating model: 25 ms

Adding embedded #jmolscript: select ({0:257});backbone only;select *;

platformSpeed = 7

cartoonsFancy = true

sheetSmoothing = 1.0

traceAlpha = true

loadScript /static/js/j2s/core/corescriptcmd.z.js

FileManager.getAtomSetCollectionFromFile(/static/knot_data/6zr9/A/6zr9_A.pdb.gz)

The Resolver thinks Pdb

Time for openFile(/static/knot_data/6zr9/A/6zr9_A.pdb.gz): 31 ms

reading 258 atoms

ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false

1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them.

Default Van der Waals type for model set to Jmol

258 atoms created

ModelSet: autobonding; use autobond=false to not generate bonds automatically

Time for creating model: 30 ms

Adding embedded #jmolscript: select ({0:257});backbone only;select *;

platformSpeed = 7

cartoonsFancy = true

sheetSmoothing = 1.0

traceAlpha = true

specularPower = 9

ambientPercent = 20

antialiasDisplay = true

FileManager.getAtomSetCollectionFromFile(/static/knot_data/6zr9/A/6zr9_A.pdb.gz)

The Resolver thinks Pdb

Time for openFile(/static/knot_data/6zr9/A/6zr9_A.pdb.gz): 20 ms

reading 258 atoms

ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false

1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them.

Default Van der Waals type for model set to Jmol

258 atoms created

ModelSet: autobonding; use autobond=false to not generate bonds automatically

Time for creating model: 16 ms

Adding embedded #jmolscript: select ({0:257});backbone only;select *;

platformSpeed = 6

specularPower = 1

ambientPercent = 20

Script completed

Jmol script terminated

loadScript /static/js/j2s/J/g3d/HermiteRenderer.js

loadScript /static/js/j2s/J/renderbio/BioMeshRenderer.js

loadScript /static/js/j2s/J/render/MeshRenderer.js

loadScript /static/js/j2s/J/shape/Mesh.js

Help Knotting data interpretation Full screen

		Knot core range	Knot core length	Knot tails range	N-end length	C-end length	Type
view details	+ 3₁	23-232	210	1-22, 233-236	22	4	knot
view details	+ 3₁	24-131	108	1-23, 132-135	23	4	knot
view details	+ 3₁	21-229	209	1-20, 230-234	20	5	knot
view details	+ 3₁	23-252	230	1-22, 253-257	22	5	knot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	Trp5 ... His96 <-> His119 ... Chain closureAla262 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Chain closureTrp5 <-> Ala262 ... Cys178 <-> Cys54 ... Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> His119 ... Chain closureAla262 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> His96 ... Chain closureAla262 <-> Trp5	probabilistic	color sequence

Chain Sequence

Whole chain analysis

Help Knotoid data interpretation Full screen

Subchain analysis

Knotoid cutoff: 0.5

Knotoid matrix content: 1

script 1 started

platformSpeed = 8

JSmol exec jmolApplet2 start applet null

Jmol JavaScript applet jmolApplet2__977326570089776__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet2__977326570089776__)

vwrOptions:

{ "name":"jmolApplet2","applet":true,"documentBase":"https://knotprot.cent.uw.edu.pl/view/6zr9/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet2__977326570089776__","codePath":"https:/static/js/j2s/","display":"jmolApplet2_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"977326570089776","bgcolor":"white" }

setting document base to "https://knotprot.cent.uw.edu.pl/view/6zr9/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet2 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet2__977326570089776__ ready

Help Knotoid subchains data interpretation Full screen

					Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details				2.1	24-251	228	1-23	257-258	252-256	23	2	slipknot

sequence length	258
structure length	258
publication title	The crystal structures of 2-(4-benzhydrylpiperazin-1-yl)-N-(4-sulfamoylphenyl)acetamide in complex with human carbonic anhydrase II and VII provide insights into selective CA inhibitor development doi rcsb
molecule tags	Lyase
molecule keywords	Carbonic anhydrase 7
source organism	Homo sapiens
total genus	Genus: 75
ec nomenclature	ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date	2020-07-11
KnotProt deposition date	2021-06-23

pfam database annotations

chain	Pfam Accession Code	Pfam Family Identifier	Pfam Description
A	PF00194	Carb_anhydrase	Eukaryotic-type carbonic anhydrase

Image from the rcsb pdb (www.rcsb.org)

3ML5A 6H36A 6H37A 6H38A 6SDTA 6ZR9A 7NC4A
similar chains in the KnotProt database (40% sequence similarity)

7P1AA 8Q3UA
similar chains in the pdb database (40% sequence similarity)

#similar chains in the KnotProt database (40% sequence similarity)
3ML5 A; 6H36 A; 6H37 A; 6H38 A; 6SDT A; 6ZR9 A; 
#similar chains, but unknotted
7NC4 A; 
#similar chains in the pdb database (40% sequence similarity)
7P1A A; 8Q3U A;

6ZR9A

Knot K +31

Chain Sequence

Knot K 4x +31

Chain Sequence

pfam database annotations

Knot K +3₁

Knot K 4x +3₁