Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
+ 31 | 20-160 | 141 | 1-19, 161-220 | 19 | 59 | slipknot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K +31 | Asp63 <-> Bridging ionFe500 <-> Tyr188 ... Cys331 <-> Cys137 ... Asp63 |
ion-based | |||
|
K +31 | Asp63 <-> Bridging ionFe500 <-> Tyr188 ... Cys227 <-> Cys241 ... Cys331 <-> Cys137 ... Asp63 |
ion-based |
Chain Sequence |
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVAHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
|
sequence length |
329
|
structure length |
329
|
publication title |
Crystal structures and iron release properties of mutants (K206A and K296A) that abolish the dilysine interaction in the N-lobe of human transferrin.
pubmed doi rcsb |
molecule tags |
Metal transport
|
molecule keywords |
SEROTRANSFERRIN
|
source organism |
Homo sapiens
|
total genus |
Genus: 100
|
ec nomenclature | |
pdb deposition date | 2000-09-04 |
KnotProt deposition date | 2018-10-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00405 | Transferrin | Transferrin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II | ||
Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II | ||
Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II | ||
Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II |
#chains in the KnotProt database with same CATH superfamily 1D3K A; 1B3E A; 2O84 X; 1A8F A; 1OQG A; 1N7X A; 1OQH A; 1D4N A; 2O7U A; 1N7W A; 1DTG A; 1FQF A; 3FGS A; 1A8E A; 3O97 A; 1FQE A; 1N84 A; 1JQF A; #chains in the KnotProt database with same CATH topology 1D3K A; 1B3E A; 2O84 X; 1A8F A; 1OQG A; 1N7X A; 1OQH A; 1D4N A; 2O7U A; 1N7W A; 1DTG A; 1FQF A; 3FGS A; 1A8E A; 3O97 A; 1FQE A; 1N84 A; 1JQF A; #chains in the KnotProt database with same CATH homology 1D3K A; 1B3E A; 2O84 X; 1A8F A; 1OQG A; 1N7X A; 1OQH A; 1D4N A; 2O7U A; 1N7W A; 1DTG A; 1FQF A; 3FGS A; 1A8E A; 3O97 A; 1FQE A; 1N84 A; 1JQF A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...