| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 19-159 | 141 | 1-18, 160-220 | 18 | 60 | slipknot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Asp63 <-> Bridging ionFe402 <-> Tyr188 ... Cys331 <-> Cys137 ... Asp63 |
ion-based | |||
|
|
K +31 | Asp63 <-> Bridging ionFe402 <-> Tyr188 ... Cys227 <-> Cys241 ... Cys331 <-> Cys137 ... Asp63 |
ion-based |
Chain Sequence |
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDARLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
|
| sequence length |
329
|
| structure length |
329
|
| publication title |
Structural and Functional Consequences of the Substitution of Glycine 65 with Arginine in the N-Lobe of Human Transferrin.
pubmed doi rcsb |
| molecule tags |
Metal transport
|
| molecule keywords |
Serotransferrin
|
| source organism |
Homo sapiens
|
| total genus |
Genus: 99
|
| ec nomenclature | |
| pdb deposition date | 2008-12-08 |
| KnotProt deposition date | 2018-10-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00405 | Transferrin | Transferrin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II | ||
| Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II | ||
| Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II | ||
| Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II |
#chains in the KnotProt database with same CATH superfamily 1DTG A; 1D4N A; 1A8F A; 1JQF A; 1B3E A; 1N7X A; 1OQG A; 1N7W A; 1D3K A; 3O97 A; 1A8E A; 1FQF A; 2O84 X; 3FGS A; 2O7U A; 1OQH A; 1N84 A; 1FQE A; #chains in the KnotProt database with same CATH topology 1DTG A; 1D4N A; 1A8F A; 1JQF A; 1B3E A; 1N7X A; 1OQG A; 1N7W A; 1D3K A; 3O97 A; 1A8E A; 1FQF A; 2O84 X; 3FGS A; 2O7U A; 1OQH A; 1N84 A; 1FQE A; #chains in the KnotProt database with same CATH homology 1DTG A; 1D4N A; 1A8F A; 1JQF A; 1B3E A; 1N7X A; 1OQG A; 1N7W A; 1D3K A; 3O97 A; 1A8E A; 1FQF A; 2O84 X; 3FGS A; 2O7U A; 1OQH A; 1N84 A; 1FQE A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...