5ZYAD

Sf3b spliceosomal complex bound to e7107
Genus: 8
Alphaknot: Q7RTV0
Knot K -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 14-63 50 1-13, 64-85 13 22 knot
Chain Sequence
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 11x -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
- 31 10-58 49 1-9, 59-76 9 18 knot
Fingerprint Knot forming loop Loop type
K -31 Cys11 ... Cys85 <->
Bridging ionZn202
<-> Cys11		 ion-based
K -31 Cys11 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ... Cys85 <->
Bridging ionZn202
<-> Cys11		 ion-based
K -31 Cys11 ... Cys30 <->
Bridging ionZn203
<-> Cys33 ... Cys85 <->
Bridging ionZn202
<-> Cys11		 ion-based
K -31 Cys11 <->
Bridging ionZn202
<-> Cys85 ... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Cys11		 ion-based
K -31 Asp7 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ...
Chain closureLeu91 <-> Asp7
 probabilistic
K -31 Asp7 ... Cys30 <->
Bridging ionZn203
<-> Cys33 ...
Chain closureLeu91 <-> Asp7
 probabilistic
K -31
Chain closureAsp7 <-> Leu91
... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Asp7		 probabilistic
K -31 Cys11 <->
Bridging ionZn202
<-> Cys85 ... Cys75 <->
Bridging ionZn203
<-> Cys72 ... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Cys11		 ion-based
K -31 Cys11 <->
Bridging ionZn202
<-> Cys85 ... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Cys33 <->
Bridging ionZn203
<-> Cys30 ... Cys11		 ion-based
K -31
Chain closureAsp7 <-> Leu91
... Cys75 <->
Bridging ionZn203
<-> Cys72 ... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Asp7		 probabilistic
K -31
Chain closureAsp7 <-> Leu91
... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Cys33 <->
Bridging ionZn203
<-> Cys30 ... Asp7		 probabilistic
Chain Sequence
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 13-66 54 1-12, 67-85 12 19 knot
sequence length 85
structure length 85
publication title The cryo-EM structure of the SF3b spliceosome complex bound to a splicing modulator reveals a pre-mRNA substrate competitive mechanism of action
pubmed doi rcsb
molecule tags Splicing
molecule keywords Splicing factor 3B subunit 5
source organism Homo sapiens
total genus Genus: 8
ec nomenclature
pdb deposition date 2018-05-23
KnotProt deposition date 2018-10-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling