1GQ6A

Proclavaminate amidino hydrolase from streptomyces clavuligerus
Slipknot S +31 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 12-78 67 1-9, 294-301 10-11, 79-293 9 8 slipknot
Chain Sequence
SPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGH------LDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 14-78 65 1-7, 100-295 8-13, 79-99 7 196 slipknot
sequence length 301
structure length 295
publication title Oligomeric Structure of Proclavaminic Acid Amidino Hydrolase: Evolution of a Hydrolytic Enzyme in Clavulanic Acid Biosynthesis
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROCLAVAMINATE AMIDINO HYDROLASE
source organism Streptomyces clavuligerus
missing residues 179-184
total genus Genus: 109
ec nomenclature ec 3.5.3.22: Proclavaminate amidinohydrolase.
pdb deposition date 2001-11-20
KnotProt deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Arginase; Chain A 1gq6A00
1WOGA 1WOIA 1GQ7A 4DZ4A 1WOHA 1GQ6A
chains in the KnotProt database with same CATH superfamily
1WOGA 1WOIA 1GQ7A 4DZ4A 1WOHA 1GQ6A
chains in the KnotProt database with same CATH topology
1WOGA 1WOIA 1GQ7A 4DZ4A 1WOHA 1GQ6A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1WOG A;  1WOI A;  1GQ7 A;  4DZ4 A;  1WOH A;  1GQ6 A; 
#chains in the KnotProt database with same CATH topology
 1WOG A;  1WOI A;  1GQ7 A;  4DZ4 A;  1WOH A;  1GQ6 A; 
#chains in the KnotProt database with same CATH homology
 1WOG A;  1WOI A;  1GQ7 A;  4DZ4 A;  1WOH A;  1GQ6 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling