Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 12-184 | 173 | 1-9, 242-301 | 10-11, 185-241 | 9 | 60 | slipknot |
Chain Sequence |
SPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGHNPKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAH
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type |
---|
sequence length |
301
|
structure length |
301
|
publication title |
Oligomeric Structure of Proclavaminic Acid Amidino Hydrolase: Evolution of a Hydrolytic Enzyme in Clavulanic Acid Biosynthesis
pubmed doi rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
PROCLAVAMINATE AMIDINO HYDROLASE
|
source organism |
Streptomyces clavuligerus
|
total genus |
![]() |
ec nomenclature |
ec
3.5.3.22: Proclavaminate amidinohydrolase. |
pdb deposition date | 2001-11-20 |
KnotProt deposition date | 2014-10-08 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Arginase; Chain A | Arginase; Chain A |
#chains in the KnotProt database with same CATH superfamily 1WOG A; 4DZ4 A; 1GQ7 A; 1GQ6 A; 1WOI A; 1WOH A; #chains in the KnotProt database with same CATH topology 1WOG A; 4DZ4 A; 1GQ7 A; 1GQ6 A; 1WOI A; 1WOH A; #chains in the KnotProt database with same CATH homology 1WOG A; 4DZ4 A; 1GQ7 A; 1GQ6 A; 1WOI A; 1WOH A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...