1WOGA

Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 15-116 102 1-12, 298-303 13-14, 117-297 12 6 slipknot
Chain Sequence
GPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHVL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 16-231 216 1-10, 241-303 11-15, 232-240 10 63 slipknot
view details
2.1 17-116 100 1-11, 137-303 12-16, 117-136 11 167 slipknot
sequence length 303
structure length 303
publication title Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords agmatinase
source organism Deinococcus radiodurans
total genus Genus: 114
ec nomenclature ec 3.5.3.11: Agmatinase.
pdb deposition date 2004-08-18
KnotProt deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Arginase; Chain A 1wogA00
4DZ4A 1GQ6A 1WOGA 1GQ7A 1WOHA 1WOIA
chains in the KnotProt database with same CATH superfamily
4DZ4A 1GQ6A 1WOGA 1GQ7A 1WOHA 1WOIA
chains in the KnotProt database with same CATH topology
4DZ4A 1GQ6A 1WOGA 1GQ7A 1WOHA 1WOIA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 4DZ4 A;  1GQ6 A;  1WOG A;  1GQ7 A;  1WOH A;  1WOI A; 
#chains in the KnotProt database with same CATH topology
 4DZ4 A;  1GQ6 A;  1WOG A;  1GQ7 A;  1WOH A;  1WOI A; 
#chains in the KnotProt database with same CATH homology
 4DZ4 A;  1GQ6 A;  1WOG A;  1GQ7 A;  1WOH A;  1WOI A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling