Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 15-152 | 138 | 1-12, 281-303 | 13-14, 153-280 | 12 | 23 | slipknot |
Chain Sequence |
GPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHVL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 16-231 | 216 | 1-10, 244-303 | 11-15, 232-243 | 10 | 60 | slipknot | |||
view details |
![]() |
2.1 | 17-123 | 107 | 1-11, 135-303 | 12-16, 124-134 | 11 | 169 | slipknot | |||
view details |
![]() |
2.1 | 17-146 | 130 | 1-11, 158-303 | 12-16, 147-157 | 11 | 146 | slipknot |
sequence length |
303
|
structure length |
303
|
publication title |
Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
pubmed doi rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
agmatinase
|
source organism |
Deinococcus radiodurans
|
total genus |
![]() |
ec nomenclature |
ec
3.5.3.11: Agmatinase. |
pdb deposition date | 2004-08-18 |
KnotProt deposition date | 2014-10-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00491 | Arginase | Arginase family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Arginase; Chain A | Arginase; Chain A |
#chains in the KnotProt database with same CATH superfamily 1WOG A; 1GQ7 A; 1GQ6 A; 4DZ4 A; 1WOI A; 1WOH A; #chains in the KnotProt database with same CATH topology 1WOG A; 1GQ7 A; 1GQ6 A; 4DZ4 A; 1WOI A; 1WOH A; #chains in the KnotProt database with same CATH homology 1WOG A; 1GQ7 A; 1GQ6 A; 4DZ4 A; 1WOI A; 1WOH A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...