1GQ7A

Proclavaminate amidino hydrolase from streptomyces clavuligerus
Slipknot S +31 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 12-184 173 1-9, 242-301 10-11, 185-241 9 60 slipknot
Chain Sequence
SPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGHNPKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 301
structure length 301
publication title Oligomeric Structure of Proclavaminic Acid Amidino Hydrolase: Evolution of a Hydrolytic Enzyme in Clavulanic Acid Biosynthesis
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROCLAVAMINATE AMIDINO HYDROLASE
source organism Streptomyces clavuligerus
total genus Genus: 106
ec nomenclature ec 3.5.3.22: Proclavaminate amidinohydrolase.
pdb deposition date 2001-11-20
KnotProt deposition date 2014-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Arginase; Chain A 1gq7A00
1WOIA 1WOHA 4DZ4A 1WOGA 1GQ6A 1GQ7A
chains in the KnotProt database with same CATH superfamily
1WOIA 1WOHA 4DZ4A 1WOGA 1GQ6A 1GQ7A
chains in the KnotProt database with same CATH topology
1WOIA 1WOHA 4DZ4A 1WOGA 1GQ6A 1GQ7A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1WOI A;  1WOH A;  4DZ4 A;  1WOG A;  1GQ6 A;  1GQ7 A; 
#chains in the KnotProt database with same CATH topology
 1WOI A;  1WOH A;  4DZ4 A;  1WOG A;  1GQ6 A;  1GQ7 A; 
#chains in the KnotProt database with same CATH homology
 1WOI A;  1WOH A;  4DZ4 A;  1WOG A;  1GQ6 A;  1GQ7 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling