1WOIA

Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
Warning
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knotoid 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 15-152 138 1-12, 281-303 13-14, 153-280 12 23 slipknot
Chain Sequence
GPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHVL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 16-231 216 1-10, 244-303 11-15, 232-243 10 60 slipknot
view details
2.1 17-123 107 1-11, 135-303 12-16, 124-134 11 169 slipknot
view details
2.1 17-146 130 1-11, 158-303 12-16, 147-157 11 146 slipknot
sequence length 303
structure length 303
publication title Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords agmatinase
source organism Deinococcus radiodurans
total genus Genus: 114
ec nomenclature ec 3.5.3.11: Agmatinase.
pdb deposition date 2004-08-18
KnotProt deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Arginase; Chain A 1woiA00
1GQ7A 1WOIA 1WOHA 1WOGA 4DZ4A 1GQ6A
chains in the KnotProt database with same CATH superfamily
1GQ7A 1WOIA 1WOHA 1WOGA 4DZ4A 1GQ6A
chains in the KnotProt database with same CATH topology
1GQ7A 1WOIA 1WOHA 1WOGA 4DZ4A 1GQ6A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1GQ7 A;  1WOI A;  1WOH A;  1WOG A;  4DZ4 A;  1GQ6 A; 
#chains in the KnotProt database with same CATH topology
 1GQ7 A;  1WOI A;  1WOH A;  1WOG A;  4DZ4 A;  1GQ6 A; 
#chains in the KnotProt database with same CATH homology
 1GQ7 A;  1WOI A;  1WOH A;  1WOG A;  4DZ4 A;  1GQ6 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling