1XD3A

Crystal structure of uchl3-ubvme complex
Knot K -52 -31 -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-52 6-226 221 1-5, 227-229 5 3 knot
view details
-31 8-168 161 1-7 225-229 169-224 7 5 slipknot
Chain Sequence
EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 7-189 183 1-6 215-229 190-214 6 15 slipknot
view details
3.1m 7-215 209 1-6 223-229 216-222 6 7 slipknot
sequence length 229
structure length 229
publication title Structure of the Ubiquitin Hydrolase UCH-L3 Complexed with a Suicide Substrate
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ubiquitin Carboxyl-terminal esterase L3
source organism Homo sapiens
total genus Genus: 81
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-09-03
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Ubiquitin C-terminal Hydrolase Uch-l3 1xd3A00
1XD3A 3RIIA 2LENA 3A7SA 3RISA 3IHRA 3KVFA 3IFWA 2ETLA 4DM9A 3KW5A 1CMXA 1UCHA 3IRTA
chains in the KnotProt database with same CATH superfamily
1XD3A 3RIIA 2LENA 3A7SA 3RISA 3IHRA 3KVFA 3IFWA 2ETLA 4DM9A 3KW5A 1CMXA 1UCHA 3IRTA
chains in the KnotProt database with same CATH topology
1XD3A 3RIIA 2LENA 3A7SA 3RISA 3IHRA 3KVFA 3IFWA 2ETLA 4DM9A 3KW5A 1CMXA 1UCHA 3IRTA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1XD3 A;  3RII A;  2LEN A;  3A7S A;  3RIS A;  3IHR A;  3KVF A;  3IFW A;  2ETL A;  4DM9 A;  3KW5 A;  1CMX A;  1UCH A;  3IRT A; 
#chains in the KnotProt database with same CATH topology
 1XD3 A;  3RII A;  2LEN A;  3A7S A;  3RIS A;  3IHR A;  3KVF A;  3IFW A;  2ETL A;  4DM9 A;  3KW5 A;  1CMX A;  1UCH A;  3IRT A; 
#chains in the KnotProt database with same CATH homology
 1XD3 A;  3RII A;  2LEN A;  3A7S A;  3RIS A;  3IHR A;  3KVF A;  3IFW A;  2ETL A;  4DM9 A;  3KW5 A;  1CMX A;  1UCH A;  3IRT A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling