3RISA

Crystal structure of the catalytic domain of uchl5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme
Warning
  • Chain breaks within knot 52 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K -52 -31 -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-52 6-218 213 1-5, 219-233 5 15 knot
view details
-31 6-159 154 1-5 214-233 160-213 5 20 slipknot
Chain Sequence
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTK------DAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1m 7-153 147 1-6 165-227 154-164 6 63 slipknot
view details
1.1m 4-164 161 1-3 169-227 165-168 3 59 slipknot
view details
3.1m 8-174 167 1-7 192-227 175-191 7 36 slipknot
view details
3.1m 4-191 188 1-3 206-227 192-205 3 22 slipknot
view details
2.1m 10-192 183 1-9 208-227 193-207 9 20 slipknot
view details
4.4m 9-213 205 214-227 1-1 2-8 1 13 slipknot
sequence length 233
structure length 227
publication title Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
source organism Homo sapiens
missing residues 149-154
total genus Genus: 69
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-04-14
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Ubiquitin C-terminal Hydrolase Uch-l3 3risA00
1CMXA 3KW5A 3KVFA 3IHRA 2ETLA 1XD3A 4DM9A 1UCHA 3RIIA 3IRTA 3RISA 3A7SA 3IFWA 2LENA
chains in the KnotProt database with same CATH superfamily
1CMXA 3KW5A 3KVFA 3IHRA 2ETLA 1XD3A 4DM9A 1UCHA 3RIIA 3IRTA 3RISA 3A7SA 3IFWA 2LENA
chains in the KnotProt database with same CATH topology
1CMXA 3KW5A 3KVFA 3IHRA 2ETLA 1XD3A 4DM9A 1UCHA 3RIIA 3IRTA 3RISA 3A7SA 3IFWA 2LENA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1CMX A;  3KW5 A;  3KVF A;  3IHR A;  2ETL A;  1XD3 A;  4DM9 A;  1UCH A;  3RII A;  3IRT A;  3RIS A;  3A7S A;  3IFW A;  2LEN A; 
#chains in the KnotProt database with same CATH topology
 1CMX A;  3KW5 A;  3KVF A;  3IHR A;  2ETL A;  1XD3 A;  4DM9 A;  1UCH A;  3RII A;  3IRT A;  3RIS A;  3A7S A;  3IFW A;  2LEN A; 
#chains in the KnotProt database with same CATH homology
 1CMX A;  3KW5 A;  3KVF A;  3IHR A;  2ETL A;  1XD3 A;  4DM9 A;  1UCH A;  3RII A;  3IRT A;  3RIS A;  3A7S A;  3IFW A;  2LEN A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling