3RIIA

Crystal structure of the catalytic domain of uchl5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme
Warning
  • Chain breaks within knot 52 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K -52 -31 -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-52 6-219 214 1-5, 220-222 5 3 knot
view details
-31 6-161 156 1-5 217-222 162-216 5 6 slipknot
Chain Sequence
GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNASATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQ----------AKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 5-154 150 1-4 161-212 155-160 4 52 slipknot
view details
2.1m 5-162 158 1-4 172-212 163-171 4 41 slipknot
view details
2.1m 8-171 164 1-7 205-212 172-204 7 8 slipknot
view details
3.1m 7-153 147 1-2, 161-212 3-6, 154-160 2 52 slipknot
view details
3.1m 8-155 148 1-6, 161-212 7-7, 156-160 6 52 slipknot
sequence length 222
structure length 212
publication title Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
source organism Homo sapiens
missing residues 142-151
total genus Genus: 68
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-04-13
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Ubiquitin C-terminal Hydrolase Uch-l3 3riiA00
3IHRA 3KVFA 3A7SA 1XD3A 2LENA 3IFWA 2ETLA 3IRTA 4DM9A 3KW5A 1UCHA 3RISA 1CMXA 3RIIA
chains in the KnotProt database with same CATH superfamily
3IHRA 3KVFA 3A7SA 1XD3A 2LENA 3IFWA 2ETLA 3IRTA 4DM9A 3KW5A 1UCHA 3RISA 1CMXA 3RIIA
chains in the KnotProt database with same CATH topology
3IHRA 3KVFA 3A7SA 1XD3A 2LENA 3IFWA 2ETLA 3IRTA 4DM9A 3KW5A 1UCHA 3RISA 1CMXA 3RIIA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3IHR A;  3KVF A;  3A7S A;  1XD3 A;  2LEN A;  3IFW A;  2ETL A;  3IRT A;  4DM9 A;  3KW5 A;  1UCH A;  3RIS A;  1CMX A;  3RII A; 
#chains in the KnotProt database with same CATH topology
 3IHR A;  3KVF A;  3A7S A;  1XD3 A;  2LEN A;  3IFW A;  2ETL A;  3IRT A;  4DM9 A;  3KW5 A;  1UCH A;  3RIS A;  1CMX A;  3RII A; 
#chains in the KnotProt database with same CATH homology
 3IHR A;  3KVF A;  3A7S A;  1XD3 A;  2LEN A;  3IFW A;  2ETL A;  3IRT A;  4DM9 A;  3KW5 A;  1UCH A;  3RIS A;  1CMX A;  3RII A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling