1FQNA

X-ray crystal structure of metal-free f93i/f95m/w97v carbonic anhydrase (caii) variant
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 26-254 229 1-25, 255-258 25 3 slipknot
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQIHMHVGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 23-250 228 1-22 257-257 251-256 22 1 slipknot
view details
3.1 24-254 231 255-257 1-4 5-23 4 2 slipknot
publication title Structural influence of hydrophobic core residues on metal binding and specificity in carbonic anhydrase II.
pubmed doi rcsb
structure length 257
molecule tags Lyase
source organism Homo sapiens
sequence length 257
molecule keywords CARBONIC ANHYDRASE
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
ec 4.2.1.1: Carbonic anhydrase.
ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2000-09-06
KnotProt deposition date 2018-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 1fqnA00
2X7SA 3N3JA 1KWQA 3F7UA 2FMGA 3BL1A 1HEAA 1FSNA 2FOSA 3KS3A 3DVCA 2CBAA 2X7TA 1CAIA 3MHOA 3CA2A 1CCUA 1OQ5A 1AM6A 1I9NA 1RZDA 1H9QA 1MUAA 1DMYA 1FQRA 1FR4A 1BNWA 1KOQA 1XEGA 9CA2A 1CAOA 1CCTA 3BL0A 1HEBA 1OKMA 3DV7A 3DVBA 3IBNA 1CAHA 1UGEA 3BETA 3DC9A 1BV3A 3OKVA 2F14A 2NNVA 1I9MA 3M5EA 2Q1QA 1CA2A 1KOPA 1BZMA 3MNUA 3JXHC 3K34A 3DBUA 2AX2A 1XPZA 3DC3A 3HS4A 3MNAA 1UGDA 1RAYA 2NWPA 2HD6A 3ML2A 1BN1A 1HCAA 3OKUA 3KONA 3N0NA 1BN3A 3M2YA 1TH9A 1I9LA 2POWA 1LUGA 3IAIA 3FFPX 3HKQA 1A42A 3ZNCA 1FQNA 2AW1A 3N2PA 1TE3X 1UGBA 1H9NA 3IBLA 2CA2A 3K7KA 1DCBA 2WEOA 2FNNA 1G3ZA 2VVAX 1ZNCA 1G48A 1G45A 1ZSAA 1Y7WA 3F8EA 2POVA 3KIGA 3M3XA 3LXEA 1UGAA 1CNCA 2IT4A 2CBEA 1CAZA 1IF5A 3DA2A 1YDDA 12CAA 2HKKA 1G46A 3PYKA 1ZSBA 2WEGA 3M98A 3HKTA 3MDZA 1AZMA 2HNCA 1G1DA 1CVHA 2POUA 1F2WA 3OIMA 1HUGA 3EFTA 1FQLA 2CBCA 3HLJA 1CA3A 8CA2A 1XQ0A 2ILIA 1YDBA 1TG9A 2CBDA 1CAYA 1IF6A 2O4ZA 3M96A 1ZSCA 3KOKA 3IQKA 2NWZA 2EZ7A 3HKUA 1I8ZA 3C7PA 1TBTX 1LZVA 1ZE8A 2NXRA 3OILA 1HUHA 1G53A 1FQMA 2CBBA 2Q1BA 3K2FA 1CNYA 2NWOA 3MHCA 1YDCA 1CRAA 2NNOA 3D9ZA 1IF7A 1HCBA 2WEJA 2FNMA 3MWOA 1CNHA 1BICA 7CA2A 1G4JA 1G6VA 2ABEA 1CVFA 3OIKA 2NNSA 3MYQA 1CNGA 3NJ9A 1CVAA 1G52A 3IBIA 2EU2A 3KWAA 1UGFA 3DCCA 2WD3A 1BCDA 1CNIA 3PO6A 3M2NA 1BN4A 1YO2A 3JXFA 3F4XA 3N4BA 3IGPA 2HFXA 3M5TA 4CA2A 1I91A 1LG5A 1IF4A 2EU3A 1EOUA 1RJ6A 3L14A 2W2JA 1YDAA 2CABA 1T9NA 2WEHA 2FNKA 1RZCA 2WD2A 2GD8A 3F7BA 1XEVA 1YO1A 1URTA 1CZMA 1LGDA 2NMXA 1THKA 3B4FA 1CVDA 2HFYA 3M5SA 1I90A 1CANA 2HOCA 1HECA 3FW3A 1J9WA 3M40A 1CRMA 6CA2A 1G0EA 1RJ5A 3MNJA 2HFWA 1BNNA 3KKXA 3R16A 3FE4A 1RZBA 3EFIA 1CNWA 2NWYA 3DCWA 2VVBX 2Q38A 1TEUX 1YO0A 1JV0A 1BNUA 3DCSA 1FLJA 1CVEA 3P4VA 1V9IC 1CAMA 5CA2A 1KWRA 1H4NA 1HEDA 1AVNA 1FR7A 1G0FA 3MNKA 1I9QA 5CACA 1BNMA 1Z97A 3GZ0A 1RZAA 1G4OA 3IEOA 3IBUA 1Z93A 1BNTA 1CVBA 4CACA 3M67A 1CALA 3M1QA 3MMFA 3MHLA 1OKNA 2FW4A 1CINA 1IF8A 3M1JA 2NN1A 1BNVA 3MNHA 1I9PA 1TG3A 2NNGA 3B1BA 3DD0A 1CNXA 1LG6A 3D0NA 3ML5A 3D8WA 1CVCA 3CAJA 1FSQA 2FOQA 2H15A 1CAKA 2NN7A 2FMZA 3MHMA 3HFPA 1CIMA 1IF9A 3MNIA 2NXTA 3R17B 3MHIA 3CZVA 2NXSA 3NI5A 1KEQA 1BNQA 3D92A 1CNJA 3MZCA 3DD8A 2OSFA 1FSRA 3DVDA 2X7UA 1CAJA 3M1WA 3HKNA 2ZNCA 1CCSA 2OSMA 1RAZA 1CILA 2FOUA 1DCAA 1I9OA 1RZEA 2GEHA 3M2ZA 2HL4A 3JXGA 1V9EA 3D93A 1JD0A 1HVAA 3DAZA 1TTMA
chains in the KnotProt database with same CATH superfamily
2X7SA 3N3JA 1KWQA 3F7UA 2FMGA 3BL1A 1HEAA 1FSNA 2FOSA 3KS3A 3DVCA 2CBAA 2X7TA 1CAIA 3MHOA 3CA2A 1CCUA 1OQ5A 1AM6A 1I9NA 1RZDA 1H9QA 1MUAA 1DMYA 1FQRA 1FR4A 1BNWA 1KOQA 1XEGA 9CA2A 1CAOA 1CCTA 3BL0A 1HEBA 1OKMA 3DV7A 3DVBA 3IBNA 1CAHA 1UGEA 3BETA 3DC9A 1BV3A 3OKVA 2F14A 2NNVA 1I9MA 3M5EA 2Q1QA 1CA2A 1KOPA 1BZMA 3MNUA 3JXHC 3K34A 3DBUA 2AX2A 1XPZA 3DC3A 3HS4A 3MNAA 1UGDA 1RAYA 2NWPA 2HD6A 3ML2A 1BN1A 1HCAA 3OKUA 3KONA 3N0NA 1BN3A 3M2YA 1TH9A 1I9LA 2POWA 1LUGA 3IAIA 3FFPX 3HKQA 1A42A 3ZNCA 1FQNA 2AW1A 3N2PA 1TE3X 1UGBA 1H9NA 3IBLA 2CA2A 3K7KA 1DCBA 2WEOA 2FNNA 1G3ZA 2VVAX 1ZNCA 1G48A 1G45A 1ZSAA 1Y7WA 3F8EA 2POVA 3KIGA 3M3XA 3LXEA 1UGAA 1CNCA 2IT4A 2CBEA 1CAZA 1IF5A 3DA2A 1YDDA 12CAA 2HKKA 1G46A 3PYKA 1ZSBA 2WEGA 3M98A 3HKTA 3MDZA 1AZMA 2HNCA 1G1DA 1CVHA 2POUA 1F2WA 3OIMA 1HUGA 3EFTA 1FQLA 2CBCA 3HLJA 1CA3A 8CA2A 1XQ0A 2ILIA 1YDBA 1TG9A 2CBDA 1CAYA 1IF6A 2O4ZA 3M96A 1ZSCA 3KOKA 3IQKA 2NWZA 2EZ7A 3HKUA 1I8ZA 3C7PA 1TBTX 1LZVA 1ZE8A 2NXRA 3OILA 1HUHA 1G53A 1FQMA 2CBBA 2Q1BA 3K2FA 1CNYA 2NWOA 3MHCA 1YDCA 1CRAA 2NNOA 3D9ZA 1IF7A 1HCBA 2WEJA 2FNMA 3MWOA 1CNHA 1BICA 7CA2A 1G4JA 1G6VA 2ABEA 1CVFA 3OIKA 2NNSA 3MYQA 1CNGA 3NJ9A 1CVAA 1G52A 3IBIA 2EU2A 3KWAA 1UGFA 3DCCA 2WD3A 1BCDA 1CNIA 3PO6A 3M2NA 1BN4A 1YO2A 3JXFA 3F4XA 3N4BA 3IGPA 2HFXA 3M5TA 4CA2A 1I91A 1LG5A 1IF4A 2EU3A 1EOUA 1RJ6A 3L14A 2W2JA 1YDAA 2CABA 1T9NA 2WEHA 2FNKA 1RZCA 2WD2A 2GD8A 3F7BA 1XEVA 1YO1A 1URTA 1CZMA 1LGDA 2NMXA 1THKA 3B4FA 1CVDA 2HFYA 3M5SA 1I90A 1CANA 2HOCA 1HECA 3FW3A 1J9WA 3M40A 1CRMA 6CA2A 1G0EA 1RJ5A 3MNJA 2HFWA 1BNNA 3KKXA 3R16A 3FE4A 1RZBA 3EFIA 1CNWA 2NWYA 3DCWA 2VVBX 2Q38A 1TEUX 1YO0A 1JV0A 1BNUA 3DCSA 1FLJA 1CVEA 3P4VA 1V9IC 1CAMA 5CA2A 1KWRA 1H4NA 1HEDA 1AVNA 1FR7A 1G0FA 3MNKA 1I9QA 5CACA 1BNMA 1Z97A 3GZ0A 1RZAA 1G4OA 3IEOA 3IBUA 1Z93A 1BNTA 1CVBA 4CACA 3M67A 1CALA 3M1QA 3MMFA 3MHLA 1OKNA 2FW4A 1CINA 1IF8A 3M1JA 2NN1A 1BNVA 3MNHA 1I9PA 1TG3A 2NNGA 3B1BA 3DD0A 1CNXA 1LG6A 3D0NA 3ML5A 3D8WA 1CVCA 3CAJA 1FSQA 2FOQA 2H15A 1CAKA 2NN7A 2FMZA 3MHMA 3HFPA 1CIMA 1IF9A 3MNIA 2NXTA 3R17B 3MHIA 3CZVA 2NXSA 3NI5A 1KEQA 1BNQA 3D92A 1CNJA 3MZCA 3DD8A 2OSFA 1FSRA 3DVDA 2X7UA 1CAJA 3M1WA 3HKNA 2ZNCA 1CCSA 2OSMA 1RAZA 1CILA 2FOUA 1DCAA 1I9OA 1RZEA 2GEHA 3M2ZA 2HL4A 3JXGA 1V9EA 3D93A 1JD0A 1HVAA 3DAZA 1TTMA
chains in the KnotProt database with same CATH topology
2X7SA 3N3JA 1KWQA 3F7UA 2FMGA 3BL1A 1HEAA 1FSNA 2FOSA 3KS3A 3DVCA 2CBAA 2X7TA 1CAIA 3MHOA 3CA2A 1CCUA 1OQ5A 1AM6A 1I9NA 1RZDA 1H9QA 1MUAA 1DMYA 1FQRA 1FR4A 1BNWA 1KOQA 1XEGA 9CA2A 1CAOA 1CCTA 3BL0A 1HEBA 1OKMA 3DV7A 3DVBA 3IBNA 1CAHA 1UGEA 3BETA 3DC9A 1BV3A 3OKVA 2F14A 2NNVA 1I9MA 3M5EA 2Q1QA 1CA2A 1KOPA 1BZMA 3MNUA 3JXHC 3K34A 3DBUA 2AX2A 1XPZA 3DC3A 3HS4A 3MNAA 1UGDA 1RAYA 2NWPA 2HD6A 3ML2A 1BN1A 1HCAA 3OKUA 3KONA 3N0NA 1BN3A 3M2YA 1TH9A 1I9LA 2POWA 1LUGA 3IAIA 3FFPX 3HKQA 1A42A 3ZNCA 1FQNA 2AW1A 3N2PA 1TE3X 1UGBA 1H9NA 3IBLA 2CA2A 3K7KA 1DCBA 2WEOA 2FNNA 1G3ZA 2VVAX 1ZNCA 1G48A 1G45A 1ZSAA 1Y7WA 3F8EA 2POVA 3KIGA 3M3XA 3LXEA 1UGAA 1CNCA 2IT4A 2CBEA 1CAZA 1IF5A 3DA2A 1YDDA 12CAA 2HKKA 1G46A 3PYKA 1ZSBA 2WEGA 3M98A 3HKTA 3MDZA 1AZMA 2HNCA 1G1DA 1CVHA 2POUA 1F2WA 3OIMA 1HUGA 3EFTA 1FQLA 2CBCA 3HLJA 1CA3A 8CA2A 1XQ0A 2ILIA 1YDBA 1TG9A 2CBDA 1CAYA 1IF6A 2O4ZA 3M96A 1ZSCA 3KOKA 3IQKA 2NWZA 2EZ7A 3HKUA 1I8ZA 3C7PA 1TBTX 1LZVA 1ZE8A 2NXRA 3OILA 1HUHA 1G53A 1FQMA 2CBBA 2Q1BA 3K2FA 1CNYA 2NWOA 3MHCA 1YDCA 1CRAA 2NNOA 3D9ZA 1IF7A 1HCBA 2WEJA 2FNMA 3MWOA 1CNHA 1BICA 7CA2A 1G4JA 1G6VA 2ABEA 1CVFA 3OIKA 2NNSA 3MYQA 1CNGA 3NJ9A 1CVAA 1G52A 3IBIA 2EU2A 3KWAA 1UGFA 3DCCA 2WD3A 1BCDA 1CNIA 3PO6A 3M2NA 1BN4A 1YO2A 3JXFA 3F4XA 3N4BA 3IGPA 2HFXA 3M5TA 4CA2A 1I91A 1LG5A 1IF4A 2EU3A 1EOUA 1RJ6A 3L14A 2W2JA 1YDAA 2CABA 1T9NA 2WEHA 2FNKA 1RZCA 2WD2A 2GD8A 3F7BA 1XEVA 1YO1A 1URTA 1CZMA 1LGDA 2NMXA 1THKA 3B4FA 1CVDA 2HFYA 3M5SA 1I90A 1CANA 2HOCA 1HECA 3FW3A 1J9WA 3M40A 1CRMA 6CA2A 1G0EA 1RJ5A 3MNJA 2HFWA 1BNNA 3KKXA 3R16A 3FE4A 1RZBA 3EFIA 1CNWA 2NWYA 3DCWA 2VVBX 2Q38A 1TEUX 1YO0A 1JV0A 1BNUA 3DCSA 1FLJA 1CVEA 3P4VA 1V9IC 1CAMA 5CA2A 1KWRA 1H4NA 1HEDA 1AVNA 1FR7A 1G0FA 3MNKA 1I9QA 5CACA 1BNMA 1Z97A 3GZ0A 1RZAA 1G4OA 3IEOA 3IBUA 1Z93A 1BNTA 1CVBA 4CACA 3M67A 1CALA 3M1QA 3MMFA 3MHLA 1OKNA 2FW4A 1CINA 1IF8A 3M1JA 2NN1A 1BNVA 3MNHA 1I9PA 1TG3A 2NNGA 3B1BA 3DD0A 1CNXA 1LG6A 3D0NA 3ML5A 3D8WA 1CVCA 3CAJA 1FSQA 2FOQA 2H15A 1CAKA 2NN7A 2FMZA 3MHMA 3HFPA 1CIMA 1IF9A 3MNIA 2NXTA 3R17B 3MHIA 3CZVA 2NXSA 3NI5A 1KEQA 1BNQA 3D92A 1CNJA 3MZCA 3DD8A 2OSFA 1FSRA 3DVDA 2X7UA 1CAJA 3M1WA 3HKNA 2ZNCA 1CCSA 2OSMA 1RAZA 1CILA 2FOUA 1DCAA 1I9OA 1RZEA 2GEHA 3M2ZA 2HL4A 3JXGA 1V9EA 3D93A 1JD0A 1HVAA 3DAZA 1TTMA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2X7S A;  3N3J A;  1KWQ A;  3F7U A;  2FMG A;  3BL1 A;  1HEA A;  1FSN A;  2FOS A;  3KS3 A;  3DVC A;  2CBA A;  2X7T A;  1CAI A;  3MHO A;  3CA2 A;  1CCU A;  1OQ5 A;  1AM6 A;  1I9N A;  1RZD A;  1H9Q A;  1MUA A;  1DMY A;  1FQR A;  1FR4 A;  1BNW A;  1KOQ A;  1XEG A;  9CA2 A;  1CAO A;  1CCT A;  3BL0 A;  1HEB A;  1OKM A;  3DV7 A;  3DVB A;  3IBN A;  1CAH A;  1UGE A;  3BET A;  3DC9 A;  1BV3 A;  3OKV A;  2F14 A;  2NNV A;  1I9M A;  3M5E A;  2Q1Q A;  1CA2 A;  1KOP A;  1BZM A;  3MNU A;  3JXH C;  3K34 A;  3DBU A;  2AX2 A;  1XPZ A;  3DC3 A;  3HS4 A;  3MNA A;  1UGD A;  1RAY A;  2NWP A;  2HD6 A;  3ML2 A;  1BN1 A;  1HCA A;  3OKU A;  3KON A;  3N0N A;  1BN3 A;  3M2Y A;  1TH9 A;  1I9L A;  2POW A;  1LUG A;  3IAI A;  3FFP X;  3HKQ A;  1A42 A;  3ZNC A;  1FQN A;  2AW1 A;  3N2P A;  1TE3 X;  1UGB A;  1H9N A;  3IBL A;  2CA2 A;  3K7K A;  1DCB A;  2WEO A;  2FNN A;  1G3Z A;  2VVA X;  1ZNC A;  1G48 A;  1G45 A;  1ZSA A;  1Y7W A;  3F8E A;  2POV A;  3KIG A;  3M3X A;  3LXE A;  1UGA A;  1CNC A;  2IT4 A;  2CBE A;  1CAZ A;  1IF5 A;  3DA2 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  3PYK A;  1ZSB A;  2WEG A;  3M98 A;  3HKT A;  3MDZ A;  1AZM A;  2HNC A;  1G1D A;  1CVH A;  2POU A;  1F2W A;  3OIM A;  1HUG A;  3EFT A;  1FQL A;  2CBC A;  3HLJ A;  1CA3 A;  8CA2 A;  1XQ0 A;  2ILI A;  1YDB A;  1TG9 A;  2CBD A;  1CAY A;  1IF6 A;  2O4Z A;  3M96 A;  1ZSC A;  3KOK A;  3IQK A;  2NWZ A;  2EZ7 A;  3HKU A;  1I8Z A;  3C7P A;  1TBT X;  1LZV A;  1ZE8 A;  2NXR A;  3OIL A;  1HUH A;  1G53 A;  1FQM A;  2CBB A;  2Q1B A;  3K2F A;  1CNY A;  2NWO A;  3MHC A;  1YDC A;  1CRA A;  2NNO A;  3D9Z A;  1IF7 A;  1HCB A;  2WEJ A;  2FNM A;  3MWO A;  1CNH A;  1BIC A;  7CA2 A;  1G4J A;  1G6V A;  2ABE A;  1CVF A;  3OIK A;  2NNS A;  3MYQ A;  1CNG A;  3NJ9 A;  1CVA A;  1G52 A;  3IBI A;  2EU2 A;  3KWA A;  1UGF A;  3DCC A;  2WD3 A;  1BCD A;  1CNI A;  3PO6 A;  3M2N A;  1BN4 A;  1YO2 A;  3JXF A;  3F4X A;  3N4B A;  3IGP A;  2HFX A;  3M5T A;  4CA2 A;  1I91 A;  1LG5 A;  1IF4 A;  2EU3 A;  1EOU A;  1RJ6 A;  3L14 A;  2W2J A;  1YDA A;  2CAB A;  1T9N A;  2WEH A;  2FNK A;  1RZC A;  2WD2 A;  2GD8 A;  3F7B A;  1XEV A;  1YO1 A;  1URT A;  1CZM A;  1LGD A;  2NMX A;  1THK A;  3B4F A;  1CVD A;  2HFY A;  3M5S A;  1I90 A;  1CAN A;  2HOC A;  1HEC A;  3FW3 A;  1J9W A;  3M40 A;  1CRM A;  6CA2 A;  1G0E A;  1RJ5 A;  3MNJ A;  2HFW A;  1BNN A;  3KKX A;  3R16 A;  3FE4 A;  1RZB A;  3EFI A;  1CNW A;  2NWY A;  3DCW A;  2VVB X;  2Q38 A;  1TEU X;  1YO0 A;  1JV0 A;  1BNU A;  3DCS A;  1FLJ A;  1CVE A;  3P4V A;  1V9I C;  1CAM A;  5CA2 A;  1KWR A;  1H4N A;  1HED A;  1AVN A;  1FR7 A;  1G0F A;  3MNK A;  1I9Q A;  5CAC A;  1BNM A;  1Z97 A;  3GZ0 A;  1RZA A;  1G4O A;  3IEO A;  3IBU A;  1Z93 A;  1BNT A;  1CVB A;  4CAC A;  3M67 A;  1CAL A;  3M1Q A;  3MMF A;  3MHL A;  1OKN A;  2FW4 A;  1CIN A;  1IF8 A;  3M1J A;  2NN1 A;  1BNV A;  3MNH A;  1I9P A;  1TG3 A;  2NNG A;  3B1B A;  3DD0 A;  1CNX A;  1LG6 A;  3D0N A;  3ML5 A;  3D8W A;  1CVC A;  3CAJ A;  1FSQ A;  2FOQ A;  2H15 A;  1CAK A;  2NN7 A;  2FMZ A;  3MHM A;  3HFP A;  1CIM A;  1IF9 A;  3MNI A;  2NXT A;  3R17 B;  3MHI A;  3CZV A;  2NXS A;  3NI5 A;  1KEQ A;  1BNQ A;  3D92 A;  1CNJ A;  3MZC A;  3DD8 A;  2OSF A;  1FSR A;  3DVD A;  2X7U A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  1CCS A;  2OSM A;  1RAZ A;  1CIL A;  2FOU A;  1DCA A;  1I9O A;  1RZE A;  2GEH A;  3M2Z A;  2HL4 A;  3JXG A;  1V9E A;  3D93 A;  1JD0 A;  1HVA A;  3DAZ A;  1TTM A; 
#chains in the KnotProt database with same CATH topology
 2X7S A;  3N3J A;  1KWQ A;  3F7U A;  2FMG A;  3BL1 A;  1HEA A;  1FSN A;  2FOS A;  3KS3 A;  3DVC A;  2CBA A;  2X7T A;  1CAI A;  3MHO A;  3CA2 A;  1CCU A;  1OQ5 A;  1AM6 A;  1I9N A;  1RZD A;  1H9Q A;  1MUA A;  1DMY A;  1FQR A;  1FR4 A;  1BNW A;  1KOQ A;  1XEG A;  9CA2 A;  1CAO A;  1CCT A;  3BL0 A;  1HEB A;  1OKM A;  3DV7 A;  3DVB A;  3IBN A;  1CAH A;  1UGE A;  3BET A;  3DC9 A;  1BV3 A;  3OKV A;  2F14 A;  2NNV A;  1I9M A;  3M5E A;  2Q1Q A;  1CA2 A;  1KOP A;  1BZM A;  3MNU A;  3JXH C;  3K34 A;  3DBU A;  2AX2 A;  1XPZ A;  3DC3 A;  3HS4 A;  3MNA A;  1UGD A;  1RAY A;  2NWP A;  2HD6 A;  3ML2 A;  1BN1 A;  1HCA A;  3OKU A;  3KON A;  3N0N A;  1BN3 A;  3M2Y A;  1TH9 A;  1I9L A;  2POW A;  1LUG A;  3IAI A;  3FFP X;  3HKQ A;  1A42 A;  3ZNC A;  1FQN A;  2AW1 A;  3N2P A;  1TE3 X;  1UGB A;  1H9N A;  3IBL A;  2CA2 A;  3K7K A;  1DCB A;  2WEO A;  2FNN A;  1G3Z A;  2VVA X;  1ZNC A;  1G48 A;  1G45 A;  1ZSA A;  1Y7W A;  3F8E A;  2POV A;  3KIG A;  3M3X A;  3LXE A;  1UGA A;  1CNC A;  2IT4 A;  2CBE A;  1CAZ A;  1IF5 A;  3DA2 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  3PYK A;  1ZSB A;  2WEG A;  3M98 A;  3HKT A;  3MDZ A;  1AZM A;  2HNC A;  1G1D A;  1CVH A;  2POU A;  1F2W A;  3OIM A;  1HUG A;  3EFT A;  1FQL A;  2CBC A;  3HLJ A;  1CA3 A;  8CA2 A;  1XQ0 A;  2ILI A;  1YDB A;  1TG9 A;  2CBD A;  1CAY A;  1IF6 A;  2O4Z A;  3M96 A;  1ZSC A;  3KOK A;  3IQK A;  2NWZ A;  2EZ7 A;  3HKU A;  1I8Z A;  3C7P A;  1TBT X;  1LZV A;  1ZE8 A;  2NXR A;  3OIL A;  1HUH A;  1G53 A;  1FQM A;  2CBB A;  2Q1B A;  3K2F A;  1CNY A;  2NWO A;  3MHC A;  1YDC A;  1CRA A;  2NNO A;  3D9Z A;  1IF7 A;  1HCB A;  2WEJ A;  2FNM A;  3MWO A;  1CNH A;  1BIC A;  7CA2 A;  1G4J A;  1G6V A;  2ABE A;  1CVF A;  3OIK A;  2NNS A;  3MYQ A;  1CNG A;  3NJ9 A;  1CVA A;  1G52 A;  3IBI A;  2EU2 A;  3KWA A;  1UGF A;  3DCC A;  2WD3 A;  1BCD A;  1CNI A;  3PO6 A;  3M2N A;  1BN4 A;  1YO2 A;  3JXF A;  3F4X A;  3N4B A;  3IGP A;  2HFX A;  3M5T A;  4CA2 A;  1I91 A;  1LG5 A;  1IF4 A;  2EU3 A;  1EOU A;  1RJ6 A;  3L14 A;  2W2J A;  1YDA A;  2CAB A;  1T9N A;  2WEH A;  2FNK A;  1RZC A;  2WD2 A;  2GD8 A;  3F7B A;  1XEV A;  1YO1 A;  1URT A;  1CZM A;  1LGD A;  2NMX A;  1THK A;  3B4F A;  1CVD A;  2HFY A;  3M5S A;  1I90 A;  1CAN A;  2HOC A;  1HEC A;  3FW3 A;  1J9W A;  3M40 A;  1CRM A;  6CA2 A;  1G0E A;  1RJ5 A;  3MNJ A;  2HFW A;  1BNN A;  3KKX A;  3R16 A;  3FE4 A;  1RZB A;  3EFI A;  1CNW A;  2NWY A;  3DCW A;  2VVB X;  2Q38 A;  1TEU X;  1YO0 A;  1JV0 A;  1BNU A;  3DCS A;  1FLJ A;  1CVE A;  3P4V A;  1V9I C;  1CAM A;  5CA2 A;  1KWR A;  1H4N A;  1HED A;  1AVN A;  1FR7 A;  1G0F A;  3MNK A;  1I9Q A;  5CAC A;  1BNM A;  1Z97 A;  3GZ0 A;  1RZA A;  1G4O A;  3IEO A;  3IBU A;  1Z93 A;  1BNT A;  1CVB A;  4CAC A;  3M67 A;  1CAL A;  3M1Q A;  3MMF A;  3MHL A;  1OKN A;  2FW4 A;  1CIN A;  1IF8 A;  3M1J A;  2NN1 A;  1BNV A;  3MNH A;  1I9P A;  1TG3 A;  2NNG A;  3B1B A;  3DD0 A;  1CNX A;  1LG6 A;  3D0N A;  3ML5 A;  3D8W A;  1CVC A;  3CAJ A;  1FSQ A;  2FOQ A;  2H15 A;  1CAK A;  2NN7 A;  2FMZ A;  3MHM A;  3HFP A;  1CIM A;  1IF9 A;  3MNI A;  2NXT A;  3R17 B;  3MHI A;  3CZV A;  2NXS A;  3NI5 A;  1KEQ A;  1BNQ A;  3D92 A;  1CNJ A;  3MZC A;  3DD8 A;  2OSF A;  1FSR A;  3DVD A;  2X7U A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  1CCS A;  2OSM A;  1RAZ A;  1CIL A;  2FOU A;  1DCA A;  1I9O A;  1RZE A;  2GEH A;  3M2Z A;  2HL4 A;  3JXG A;  1V9E A;  3D93 A;  1JD0 A;  1HVA A;  3DAZ A;  1TTM A; 
#chains in the KnotProt database with same CATH homology
 2X7S A;  3N3J A;  1KWQ A;  3F7U A;  2FMG A;  3BL1 A;  1HEA A;  1FSN A;  2FOS A;  3KS3 A;  3DVC A;  2CBA A;  2X7T A;  1CAI A;  3MHO A;  3CA2 A;  1CCU A;  1OQ5 A;  1AM6 A;  1I9N A;  1RZD A;  1H9Q A;  1MUA A;  1DMY A;  1FQR A;  1FR4 A;  1BNW A;  1KOQ A;  1XEG A;  9CA2 A;  1CAO A;  1CCT A;  3BL0 A;  1HEB A;  1OKM A;  3DV7 A;  3DVB A;  3IBN A;  1CAH A;  1UGE A;  3BET A;  3DC9 A;  1BV3 A;  3OKV A;  2F14 A;  2NNV A;  1I9M A;  3M5E A;  2Q1Q A;  1CA2 A;  1KOP A;  1BZM A;  3MNU A;  3JXH C;  3K34 A;  3DBU A;  2AX2 A;  1XPZ A;  3DC3 A;  3HS4 A;  3MNA A;  1UGD A;  1RAY A;  2NWP A;  2HD6 A;  3ML2 A;  1BN1 A;  1HCA A;  3OKU A;  3KON A;  3N0N A;  1BN3 A;  3M2Y A;  1TH9 A;  1I9L A;  2POW A;  1LUG A;  3IAI A;  3FFP X;  3HKQ A;  1A42 A;  3ZNC A;  1FQN A;  2AW1 A;  3N2P A;  1TE3 X;  1UGB A;  1H9N A;  3IBL A;  2CA2 A;  3K7K A;  1DCB A;  2WEO A;  2FNN A;  1G3Z A;  2VVA X;  1ZNC A;  1G48 A;  1G45 A;  1ZSA A;  1Y7W A;  3F8E A;  2POV A;  3KIG A;  3M3X A;  3LXE A;  1UGA A;  1CNC A;  2IT4 A;  2CBE A;  1CAZ A;  1IF5 A;  3DA2 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  3PYK A;  1ZSB A;  2WEG A;  3M98 A;  3HKT A;  3MDZ A;  1AZM A;  2HNC A;  1G1D A;  1CVH A;  2POU A;  1F2W A;  3OIM A;  1HUG A;  3EFT A;  1FQL A;  2CBC A;  3HLJ A;  1CA3 A;  8CA2 A;  1XQ0 A;  2ILI A;  1YDB A;  1TG9 A;  2CBD A;  1CAY A;  1IF6 A;  2O4Z A;  3M96 A;  1ZSC A;  3KOK A;  3IQK A;  2NWZ A;  2EZ7 A;  3HKU A;  1I8Z A;  3C7P A;  1TBT X;  1LZV A;  1ZE8 A;  2NXR A;  3OIL A;  1HUH A;  1G53 A;  1FQM A;  2CBB A;  2Q1B A;  3K2F A;  1CNY A;  2NWO A;  3MHC A;  1YDC A;  1CRA A;  2NNO A;  3D9Z A;  1IF7 A;  1HCB A;  2WEJ A;  2FNM A;  3MWO A;  1CNH A;  1BIC A;  7CA2 A;  1G4J A;  1G6V A;  2ABE A;  1CVF A;  3OIK A;  2NNS A;  3MYQ A;  1CNG A;  3NJ9 A;  1CVA A;  1G52 A;  3IBI A;  2EU2 A;  3KWA A;  1UGF A;  3DCC A;  2WD3 A;  1BCD A;  1CNI A;  3PO6 A;  3M2N A;  1BN4 A;  1YO2 A;  3JXF A;  3F4X A;  3N4B A;  3IGP A;  2HFX A;  3M5T A;  4CA2 A;  1I91 A;  1LG5 A;  1IF4 A;  2EU3 A;  1EOU A;  1RJ6 A;  3L14 A;  2W2J A;  1YDA A;  2CAB A;  1T9N A;  2WEH A;  2FNK A;  1RZC A;  2WD2 A;  2GD8 A;  3F7B A;  1XEV A;  1YO1 A;  1URT A;  1CZM A;  1LGD A;  2NMX A;  1THK A;  3B4F A;  1CVD A;  2HFY A;  3M5S A;  1I90 A;  1CAN A;  2HOC A;  1HEC A;  3FW3 A;  1J9W A;  3M40 A;  1CRM A;  6CA2 A;  1G0E A;  1RJ5 A;  3MNJ A;  2HFW A;  1BNN A;  3KKX A;  3R16 A;  3FE4 A;  1RZB A;  3EFI A;  1CNW A;  2NWY A;  3DCW A;  2VVB X;  2Q38 A;  1TEU X;  1YO0 A;  1JV0 A;  1BNU A;  3DCS A;  1FLJ A;  1CVE A;  3P4V A;  1V9I C;  1CAM A;  5CA2 A;  1KWR A;  1H4N A;  1HED A;  1AVN A;  1FR7 A;  1G0F A;  3MNK A;  1I9Q A;  5CAC A;  1BNM A;  1Z97 A;  3GZ0 A;  1RZA A;  1G4O A;  3IEO A;  3IBU A;  1Z93 A;  1BNT A;  1CVB A;  4CAC A;  3M67 A;  1CAL A;  3M1Q A;  3MMF A;  3MHL A;  1OKN A;  2FW4 A;  1CIN A;  1IF8 A;  3M1J A;  2NN1 A;  1BNV A;  3MNH A;  1I9P A;  1TG3 A;  2NNG A;  3B1B A;  3DD0 A;  1CNX A;  1LG6 A;  3D0N A;  3ML5 A;  3D8W A;  1CVC A;  3CAJ A;  1FSQ A;  2FOQ A;  2H15 A;  1CAK A;  2NN7 A;  2FMZ A;  3MHM A;  3HFP A;  1CIM A;  1IF9 A;  3MNI A;  2NXT A;  3R17 B;  3MHI A;  3CZV A;  2NXS A;  3NI5 A;  1KEQ A;  1BNQ A;  3D92 A;  1CNJ A;  3MZC A;  3DD8 A;  2OSF A;  1FSR A;  3DVD A;  2X7U A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  1CCS A;  2OSM A;  1RAZ A;  1CIL A;  2FOU A;  1DCA A;  1I9O A;  1RZE A;  2GEH A;  3M2Z A;  2HL4 A;  3JXG A;  1V9E A;  3D93 A;  1JD0 A;  1HVA A;  3DAZ A;  1TTM A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling