3IQKA

Human carbonic anhydrase ii h64a complexed with thioxolone hydrolysis products
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 26-253 228 1-25, 254-257 25 4 knot
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
sequence length 257
structure length 257
publication title Synchrotron Radiation Provides a Plausible Explanation for the Generation of a Free Radical Adduct of Thioxolone in Mutant Carbonic Anhydrase II
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
source organism Homo sapiens
ec nomenclature
pdb deposition date2009-08-20
KnotProt deposition date2014-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 3iqkA00
1Z9YA 2X7SA 3N3JA 1CCUA 3F7UA 2FMGA 3BL1A 1HEAA 1FSNA 2FOSA 3KS3A 1ZGFA 3T84A 3DVCA 2CBAA 2X7TA 1CAIA 3V3JA 3TVOX 3MHOA 3RG3A 1RAYA 1BN3A 1OQ5A 1AM6A 1I9NA 1RZDA 3S9TA 1H9QA 3S76A 4FL7A 1MUAA 3KOIA 1DMYA 1FQRA 1FR4A 3S73B 1BNWA 3P55A 1KOQA 1XEGA 9CA2A 3PJJA 4E3FA 1CAOA 1CCTA 3BL0A 1HEBA 1OKMA 3DV7A 3DVBA 3IBNA 1CAHA 3NB5A 3RZ5A 1UGEA 3BETA 3DC9A 1BV3A 3OKVA 3QYKA 2F14A 3M2XA 4G0CA 2NNVA 1I9MA 3M5EA 2Q1QA 4E49A 1BNVA 1BZMA 2FOYA 3MNUA 3N0NA 3K34A 3CZVA 2AX2A 1UGCA 1XPZA 3V3HB 1OKLA 3DC3A 3HS4A 3MNAA 1UGDA 3U45X 3CA2A 2NWPA 2HD6A 3ML2A 1BN1A 3RZ1B 1HCAA 3OKUA 3KONA 3P3JA 4E3DA 3JXHC 3M2YA 1TH9A 1I9LA 2POWA 1LUGA 3IAIA 3K7KA 3HKQA 1A42A 1ZH9A 3ZNCA 1FQNA 2AW1A 3N2PA 1TE3X 2QOAA 1UGBA 1CNBA 1H9NA 3IBLA 3RYYA 2CA2A 1IF4A 1DCBA 2WEOA 2FNNA 1G3ZA 2VVAX 1ZNCA 1G48A 1G45A 1ZSAA 3OYQA 1Y7WA 3F8EA 1J9WA 3S71B 3KIGA 3M3XA 3LXEA 4BCWA 3RZ0B 3SAPA 3V3IB 1UGAA 1CNCA 2IT4A 3RG4A 2CBEA 1CAZA 1IF5A 3S78B 3DA2A 1YDDA 12CAA 2HKKA 1G46A 1ZFKA 3PYKA 1ZSBA 2WEGA 3S74B 3CYUA 4FIKA 3M98A 3HKTA 3MDZA 1AZMA 2HNCA 1G1DA 1CVHA 2POUA 1F2WA 3V5GA 3OIMA 1HUGA 3EFTA 1G54A 3FFPX 3W6IA 2CBCA 1TB0X 3HLJA 1CA3A 8CA2A 1XQ0A 3KNEA 2ILIA 1YDBA 1TG9A 2CBDA 1CAYA 1IF6A 3SAXA 3V3GB 1CNKA 2O4ZA 3M96A 4E4AA 1ZSCA 3KOKA 3IQKA 2NWZA 2EZ7A 3HKUA 1I8ZA 3C7PA 3T5ZA 1TBTX 1LZVA 1ZE8A 3M04A 1ZFQA 2FOVA 2NXRA 3OILA 1HUHA 3U7CA 1G53A 1FQMA 2CBBA 2Q1BA 1MOOA 3K2FA 1UGGA 1CNYA 2NWOA 3MHCA 1YDCA 3RLDA 3RYXB 1CRAA 3MNKA 3IEOA 1IF7A 3U3AX 1HCBA 2WEJA 2FNMA 3MWOA 1CNHA 1BICA 7CA2A 3RGEA 3V2JA 1G4JA 3PO6A 1G6VA 3RYJB 2ABEA 1CVFA 2GEHA 2NNSA 3MYQA 1CNGA 3NJ9A 1CVAA 1G52A 3IBIA 2EU2A 3KWAA 1UGFA 4ILXA 3DCCA 3T5UA 3P3HA 2WD3A 1BCDA 1CNIA 1T9NA 1FQLA 3M2NA 1BN4A 3S72B 3P5AA 3V2MA 1YO2A 3JXFA 3V7XA 3F4XA 3N4BA 3IGPA 2HFXA 3M5TA 4CA2A 1I91A 3OY0A 1LG5A 3SBHA 3UYNA 4E3GA 2EU3A 1EOUA 1RJ6A 3L14A 2W2JA 1YDAA 1TEQX 2CABA 2QO8A 2WEHA 2FNKA 1RZCA 2WD2A 2GD8A 3M14A 3F7BA 1XEVA 1YO1A 1URTA 1CZMA 1LGDA 2NMXA 1THKA 3B4FA 1CVDA 2HFYA 3M5SA 1I90A 4IDRX 1CANA 2HOCA 1HECA 3FW3A 2H4NA 2POVA 3M40A 1CRMA 3TVNX 1HVAA 1G0EA 1RJ5A 3MNJA 2HFWA 1BNNA 3KKXA 3R16A 3FE4A 1RZBA 3EFIA 1CNWA 2NWYA 3DCWA 2VVBX 2Q38A 1TEUX 3V3FA 1YO0A 1JV0A 1BNUA 3DCSA 1FLJA 1CVEA 3P4VA 1V9IC 1CAMA 5CA2A 1KWRA 1H4NA 1HEDA 1AVNA 1CVBA 3M1KA 1G0FA 3RZ7A 2NNOA 1I9QA 5CACA 1BNMA 1Z97A 3GZ0A 1RZAA 1G4OA 3D9ZA 3S77B 3W6HA 3IBUA 1Z93A 3P5LA 1BNTA 3RYVB 1FR7A 4CACA 3T83A 3M67A 1CALA 3M1QA 3MMFA 2QP6A 3MHLA 1OKNA 2FW4A 1CINA 1IF8A 3M1JA 2NN1A 1CA2A 3MNHA 1I9PA 1JCZA 1KWQA 3UYQA 3P44A 1TG3A 3RJ7A 2NNGA 1CNXA 3SBIA 3TMJA 3DD0A 1LG6A 3D0NA 3ML5A 3D8WA 1CVCA 3CAJA 1FSQA 2FOQA 3RYZA 3T82A 2H15A 1CAKA 2NN7A 3P58A 3RZ8A 3B1BA 2FMZA 3MHMA 3HFPA 1CIMA 1IF9A 3MNIA 2NXTA 3R17B 3MHIA 3DBUA 2NXSA 3NI5A 2HL4A 3U47A 3OYSA 1BNQA 3D92A 1CNJA 3MZCA 3VBDA 3DD8A 2OSFA 4E3HA 1FSRA 1ZGEA 3T85A 3DVDA 2X7UA 1CAJA 3M1WA 3HKNA 2ZNCA 1CCSA 2OSMA 1RAZA 1CILA 2FOUA 1DCAA 1I9OA 1RZEA 3OIKA 3M2ZA 3S75B 1DMXA 1KEQA 3JXGA 1V9EA 3D93A 1JD0A 6CA2A 3S8XA 3DAZA 1TTMA
chains in the KnotProt database with same CATH superfamily
1Z9YA 2X7SA 3N3JA 1CCUA 3F7UA 2FMGA 3BL1A 1HEAA 1FSNA 2FOSA 3KS3A 1ZGFA 3T84A 3DVCA 2CBAA 2X7TA 1CAIA 3V3JA 3TVOX 3MHOA 3RG3A 1RAYA 1BN3A 1OQ5A 1AM6A 1I9NA 1RZDA 3S9TA 1H9QA 3S76A 4FL7A 1MUAA 3KOIA 1DMYA 1FQRA 1FR4A 3S73B 1BNWA 3P55A 1KOQA 1XEGA 9CA2A 3PJJA 4E3FA 1CAOA 1CCTA 3BL0A 1HEBA 1OKMA 3DV7A 3DVBA 3IBNA 1CAHA 3NB5A 3RZ5A 1UGEA 3BETA 3DC9A 1BV3A 3OKVA 3QYKA 2F14A 3M2XA 4G0CA 2NNVA 1I9MA 3M5EA 2Q1QA 4E49A 1BNVA 1BZMA 2FOYA 3MNUA 3N0NA 3K34A 3CZVA 2AX2A 1UGCA 1XPZA 3V3HB 1OKLA 3DC3A 3HS4A 3MNAA 1UGDA 3U45X 3CA2A 2NWPA 2HD6A 3ML2A 1BN1A 3RZ1B 1HCAA 3OKUA 3KONA 3P3JA 4E3DA 3JXHC 3M2YA 1TH9A 1I9LA 2POWA 1LUGA 3IAIA 3K7KA 3HKQA 1A42A 1ZH9A 3ZNCA 1FQNA 2AW1A 3N2PA 1TE3X 2QOAA 1UGBA 1CNBA 1H9NA 3IBLA 3RYYA 2CA2A 1IF4A 1DCBA 2WEOA 2FNNA 1G3ZA 2VVAX 1ZNCA 1G48A 1G45A 1ZSAA 3OYQA 1Y7WA 3F8EA 1J9WA 3S71B 3KIGA 3M3XA 3LXEA 4BCWA 3RZ0B 3SAPA 3V3IB 1UGAA 1CNCA 2IT4A 3RG4A 2CBEA 1CAZA 1IF5A 3S78B 3DA2A 1YDDA 12CAA 2HKKA 1G46A 1ZFKA 3PYKA 1ZSBA 2WEGA 3S74B 3CYUA 4FIKA 3M98A 3HKTA 3MDZA 1AZMA 2HNCA 1G1DA 1CVHA 2POUA 1F2WA 3V5GA 3OIMA 1HUGA 3EFTA 1G54A 3FFPX 3W6IA 2CBCA 1TB0X 3HLJA 1CA3A 8CA2A 1XQ0A 3KNEA 2ILIA 1YDBA 1TG9A 2CBDA 1CAYA 1IF6A 3SAXA 3V3GB 1CNKA 2O4ZA 3M96A 4E4AA 1ZSCA 3KOKA 3IQKA 2NWZA 2EZ7A 3HKUA 1I8ZA 3C7PA 3T5ZA 1TBTX 1LZVA 1ZE8A 3M04A 1ZFQA 2FOVA 2NXRA 3OILA 1HUHA 3U7CA 1G53A 1FQMA 2CBBA 2Q1BA 1MOOA 3K2FA 1UGGA 1CNYA 2NWOA 3MHCA 1YDCA 3RLDA 3RYXB 1CRAA 3MNKA 3IEOA 1IF7A 3U3AX 1HCBA 2WEJA 2FNMA 3MWOA 1CNHA 1BICA 7CA2A 3RGEA 3V2JA 1G4JA 3PO6A 1G6VA 3RYJB 2ABEA 1CVFA 2GEHA 2NNSA 3MYQA 1CNGA 3NJ9A 1CVAA 1G52A 3IBIA 2EU2A 3KWAA 1UGFA 4ILXA 3DCCA 3T5UA 3P3HA 2WD3A 1BCDA 1CNIA 1T9NA 1FQLA 3M2NA 1BN4A 3S72B 3P5AA 3V2MA 1YO2A 3JXFA 3V7XA 3F4XA 3N4BA 3IGPA 2HFXA 3M5TA 4CA2A 1I91A 3OY0A 1LG5A 3SBHA 3UYNA 4E3GA 2EU3A 1EOUA 1RJ6A 3L14A 2W2JA 1YDAA 1TEQX 2CABA 2QO8A 2WEHA 2FNKA 1RZCA 2WD2A 2GD8A 3M14A 3F7BA 1XEVA 1YO1A 1URTA 1CZMA 1LGDA 2NMXA 1THKA 3B4FA 1CVDA 2HFYA 3M5SA 1I90A 4IDRX 1CANA 2HOCA 1HECA 3FW3A 2H4NA 2POVA 3M40A 1CRMA 3TVNX 1HVAA 1G0EA 1RJ5A 3MNJA 2HFWA 1BNNA 3KKXA 3R16A 3FE4A 1RZBA 3EFIA 1CNWA 2NWYA 3DCWA 2VVBX 2Q38A 1TEUX 3V3FA 1YO0A 1JV0A 1BNUA 3DCSA 1FLJA 1CVEA 3P4VA 1V9IC 1CAMA 5CA2A 1KWRA 1H4NA 1HEDA 1AVNA 1CVBA 3M1KA 1G0FA 3RZ7A 2NNOA 1I9QA 5CACA 1BNMA 1Z97A 3GZ0A 1RZAA 1G4OA 3D9ZA 3S77B 3W6HA 3IBUA 1Z93A 3P5LA 1BNTA 3RYVB 1FR7A 4CACA 3T83A 3M67A 1CALA 3M1QA 3MMFA 2QP6A 3MHLA 1OKNA 2FW4A 1CINA 1IF8A 3M1JA 2NN1A 1CA2A 3MNHA 1I9PA 1JCZA 1KWQA 3UYQA 3P44A 1TG3A 3RJ7A 2NNGA 1CNXA 3SBIA 3TMJA 3DD0A 1LG6A 3D0NA 3ML5A 3D8WA 1CVCA 3CAJA 1FSQA 2FOQA 3RYZA 3T82A 2H15A 1CAKA 2NN7A 3P58A 3RZ8A 3B1BA 2FMZA 3MHMA 3HFPA 1CIMA 1IF9A 3MNIA 2NXTA 3R17B 3MHIA 3DBUA 2NXSA 3NI5A 2HL4A 3U47A 3OYSA 1BNQA 3D92A 1CNJA 3MZCA 3VBDA 3DD8A 2OSFA 4E3HA 1FSRA 1ZGEA 3T85A 3DVDA 2X7UA 1CAJA 3M1WA 3HKNA 2ZNCA 1CCSA 2OSMA 1RAZA 1CILA 2FOUA 1DCAA 1I9OA 1RZEA 3OIKA 3M2ZA 3S75B 1DMXA 1KEQA 3JXGA 1V9EA 3D93A 1JD0A 6CA2A 3S8XA 3DAZA 1TTMA
chains in the KnotProt database with same CATH topology
1Z9YA 2X7SA 3N3JA 1CCUA 3F7UA 2FMGA 3BL1A 1HEAA 1FSNA 2FOSA 3KS3A 1ZGFA 3T84A 3DVCA 2CBAA 2X7TA 1CAIA 3V3JA 3TVOX 3MHOA 3RG3A 1RAYA 1BN3A 1OQ5A 1AM6A 1I9NA 1RZDA 3S9TA 1H9QA 3S76A 4FL7A 1MUAA 3KOIA 1DMYA 1FQRA 1FR4A 3S73B 1BNWA 3P55A 1KOQA 1XEGA 9CA2A 3PJJA 4E3FA 1CAOA 1CCTA 3BL0A 1HEBA 1OKMA 3DV7A 3DVBA 3IBNA 1CAHA 3NB5A 3RZ5A 1UGEA 3BETA 3DC9A 1BV3A 3OKVA 3QYKA 2F14A 3M2XA 4G0CA 2NNVA 1I9MA 3M5EA 2Q1QA 4E49A 1BNVA 1BZMA 2FOYA 3MNUA 3N0NA 3K34A 3CZVA 2AX2A 1UGCA 1XPZA 3V3HB 1OKLA 3DC3A 3HS4A 3MNAA 1UGDA 3U45X 3CA2A 2NWPA 2HD6A 3ML2A 1BN1A 3RZ1B 1HCAA 3OKUA 3KONA 3P3JA 4E3DA 3JXHC 3M2YA 1TH9A 1I9LA 2POWA 1LUGA 3IAIA 3K7KA 3HKQA 1A42A 1ZH9A 3ZNCA 1FQNA 2AW1A 3N2PA 1TE3X 2QOAA 1UGBA 1CNBA 1H9NA 3IBLA 3RYYA 2CA2A 1IF4A 1DCBA 2WEOA 2FNNA 1G3ZA 2VVAX 1ZNCA 1G48A 1G45A 1ZSAA 3OYQA 1Y7WA 3F8EA 1J9WA 3S71B 3KIGA 3M3XA 3LXEA 4BCWA 3RZ0B 3SAPA 3V3IB 1UGAA 1CNCA 2IT4A 3RG4A 2CBEA 1CAZA 1IF5A 3S78B 3DA2A 1YDDA 12CAA 2HKKA 1G46A 1ZFKA 3PYKA 1ZSBA 2WEGA 3S74B 3CYUA 4FIKA 3M98A 3HKTA 3MDZA 1AZMA 2HNCA 1G1DA 1CVHA 2POUA 1F2WA 3V5GA 3OIMA 1HUGA 3EFTA 1G54A 3FFPX 3W6IA 2CBCA 1TB0X 3HLJA 1CA3A 8CA2A 1XQ0A 3KNEA 2ILIA 1YDBA 1TG9A 2CBDA 1CAYA 1IF6A 3SAXA 3V3GB 1CNKA 2O4ZA 3M96A 4E4AA 1ZSCA 3KOKA 3IQKA 2NWZA 2EZ7A 3HKUA 1I8ZA 3C7PA 3T5ZA 1TBTX 1LZVA 1ZE8A 3M04A 1ZFQA 2FOVA 2NXRA 3OILA 1HUHA 3U7CA 1G53A 1FQMA 2CBBA 2Q1BA 1MOOA 3K2FA 1UGGA 1CNYA 2NWOA 3MHCA 1YDCA 3RLDA 3RYXB 1CRAA 3MNKA 3IEOA 1IF7A 3U3AX 1HCBA 2WEJA 2FNMA 3MWOA 1CNHA 1BICA 7CA2A 3RGEA 3V2JA 1G4JA 3PO6A 1G6VA 3RYJB 2ABEA 1CVFA 2GEHA 2NNSA 3MYQA 1CNGA 3NJ9A 1CVAA 1G52A 3IBIA 2EU2A 3KWAA 1UGFA 4ILXA 3DCCA 3T5UA 3P3HA 2WD3A 1BCDA 1CNIA 1T9NA 1FQLA 3M2NA 1BN4A 3S72B 3P5AA 3V2MA 1YO2A 3JXFA 3V7XA 3F4XA 3N4BA 3IGPA 2HFXA 3M5TA 4CA2A 1I91A 3OY0A 1LG5A 3SBHA 3UYNA 4E3GA 2EU3A 1EOUA 1RJ6A 3L14A 2W2JA 1YDAA 1TEQX 2CABA 2QO8A 2WEHA 2FNKA 1RZCA 2WD2A 2GD8A 3M14A 3F7BA 1XEVA 1YO1A 1URTA 1CZMA 1LGDA 2NMXA 1THKA 3B4FA 1CVDA 2HFYA 3M5SA 1I90A 4IDRX 1CANA 2HOCA 1HECA 3FW3A 2H4NA 2POVA 3M40A 1CRMA 3TVNX 1HVAA 1G0EA 1RJ5A 3MNJA 2HFWA 1BNNA 3KKXA 3R16A 3FE4A 1RZBA 3EFIA 1CNWA 2NWYA 3DCWA 2VVBX 2Q38A 1TEUX 3V3FA 1YO0A 1JV0A 1BNUA 3DCSA 1FLJA 1CVEA 3P4VA 1V9IC 1CAMA 5CA2A 1KWRA 1H4NA 1HEDA 1AVNA 1CVBA 3M1KA 1G0FA 3RZ7A 2NNOA 1I9QA 5CACA 1BNMA 1Z97A 3GZ0A 1RZAA 1G4OA 3D9ZA 3S77B 3W6HA 3IBUA 1Z93A 3P5LA 1BNTA 3RYVB 1FR7A 4CACA 3T83A 3M67A 1CALA 3M1QA 3MMFA 2QP6A 3MHLA 1OKNA 2FW4A 1CINA 1IF8A 3M1JA 2NN1A 1CA2A 3MNHA 1I9PA 1JCZA 1KWQA 3UYQA 3P44A 1TG3A 3RJ7A 2NNGA 1CNXA 3SBIA 3TMJA 3DD0A 1LG6A 3D0NA 3ML5A 3D8WA 1CVCA 3CAJA 1FSQA 2FOQA 3RYZA 3T82A 2H15A 1CAKA 2NN7A 3P58A 3RZ8A 3B1BA 2FMZA 3MHMA 3HFPA 1CIMA 1IF9A 3MNIA 2NXTA 3R17B 3MHIA 3DBUA 2NXSA 3NI5A 2HL4A 3U47A 3OYSA 1BNQA 3D92A 1CNJA 3MZCA 3VBDA 3DD8A 2OSFA 4E3HA 1FSRA 1ZGEA 3T85A 3DVDA 2X7UA 1CAJA 3M1WA 3HKNA 2ZNCA 1CCSA 2OSMA 1RAZA 1CILA 2FOUA 1DCAA 1I9OA 1RZEA 3OIKA 3M2ZA 3S75B 1DMXA 1KEQA 3JXGA 1V9EA 3D93A 1JD0A 6CA2A 3S8XA 3DAZA 1TTMA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1Z9Y A;  2X7S A;  3N3J A;  1CCU A;  3F7U A;  2FMG A;  3BL1 A;  1HEA A;  1FSN A;  2FOS A;  3KS3 A;  1ZGF A;  3T84 A;  3DVC A;  2CBA A;  2X7T A;  1CAI A;  3V3J A;  3TVO X;  3MHO A;  3RG3 A;  1RAY A;  1BN3 A;  1OQ5 A;  1AM6 A;  1I9N A;  1RZD A;  3S9T A;  1H9Q A;  3S76 A;  4FL7 A;  1MUA A;  3KOI A;  1DMY A;  1FQR A;  1FR4 A;  3S73 B;  1BNW A;  3P55 A;  1KOQ A;  1XEG A;  9CA2 A;  3PJJ A;  4E3F A;  1CAO A;  1CCT A;  3BL0 A;  1HEB A;  1OKM A;  3DV7 A;  3DVB A;  3IBN A;  1CAH A;  3NB5 A;  3RZ5 A;  1UGE A;  3BET A;  3DC9 A;  1BV3 A;  3OKV A;  3QYK A;  2F14 A;  3M2X A;  4G0C A;  2NNV A;  1I9M A;  3M5E A;  2Q1Q A;  4E49 A;  1BNV A;  1BZM A;  2FOY A;  3MNU A;  3N0N A;  3K34 A;  3CZV A;  2AX2 A;  1UGC A;  1XPZ A;  3V3H B;  1OKL A;  3DC3 A;  3HS4 A;  3MNA A;  1UGD A;  3U45 X;  3CA2 A;  2NWP A;  2HD6 A;  3ML2 A;  1BN1 A;  3RZ1 B;  1HCA A;  3OKU A;  3KON A;  3P3J A;  4E3D A;  3JXH C;  3M2Y A;  1TH9 A;  1I9L A;  2POW A;  1LUG A;  3IAI A;  3K7K A;  3HKQ A;  1A42 A;  1ZH9 A;  3ZNC A;  1FQN A;  2AW1 A;  3N2P A;  1TE3 X;  2QOA A;  1UGB A;  1CNB A;  1H9N A;  3IBL A;  3RYY A;  2CA2 A;  1IF4 A;  1DCB A;  2WEO A;  2FNN A;  1G3Z A;  2VVA X;  1ZNC A;  1G48 A;  1G45 A;  1ZSA A;  3OYQ A;  1Y7W A;  3F8E A;  1J9W A;  3S71 B;  3KIG A;  3M3X A;  3LXE A;  4BCW A;  3RZ0 B;  3SAP A;  3V3I B;  1UGA A;  1CNC A;  2IT4 A;  3RG4 A;  2CBE A;  1CAZ A;  1IF5 A;  3S78 B;  3DA2 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  1ZFK A;  3PYK A;  1ZSB A;  2WEG A;  3S74 B;  3CYU A;  4FIK A;  3M98 A;  3HKT A;  3MDZ A;  1AZM A;  2HNC A;  1G1D A;  1CVH A;  2POU A;  1F2W A;  3V5G A;  3OIM A;  1HUG A;  3EFT A;  1G54 A;  3FFP X;  3W6I A;  2CBC A;  1TB0 X;  3HLJ A;  1CA3 A;  8CA2 A;  1XQ0 A;  3KNE A;  2ILI A;  1YDB A;  1TG9 A;  2CBD A;  1CAY A;  1IF6 A;  3SAX A;  3V3G B;  1CNK A;  2O4Z A;  3M96 A;  4E4A A;  1ZSC A;  3KOK A;  3IQK A;  2NWZ A;  2EZ7 A;  3HKU A;  1I8Z A;  3C7P A;  3T5Z A;  1TBT X;  1LZV A;  1ZE8 A;  3M04 A;  1ZFQ A;  2FOV A;  2NXR A;  3OIL A;  1HUH A;  3U7C A;  1G53 A;  1FQM A;  2CBB A;  2Q1B A;  1MOO A;  3K2F A;  1UGG A;  1CNY A;  2NWO A;  3MHC A;  1YDC A;  3RLD A;  3RYX B;  1CRA A;  3MNK A;  3IEO A;  1IF7 A;  3U3A X;  1HCB A;  2WEJ A;  2FNM A;  3MWO A;  1CNH A;  1BIC A;  7CA2 A;  3RGE A;  3V2J A;  1G4J A;  3PO6 A;  1G6V A;  3RYJ B;  2ABE A;  1CVF A;  2GEH A;  2NNS A;  3MYQ A;  1CNG A;  3NJ9 A;  1CVA A;  1G52 A;  3IBI A;  2EU2 A;  3KWA A;  1UGF A;  4ILX A;  3DCC A;  3T5U A;  3P3H A;  2WD3 A;  1BCD A;  1CNI A;  1T9N A;  1FQL A;  3M2N A;  1BN4 A;  3S72 B;  3P5A A;  3V2M A;  1YO2 A;  3JXF A;  3V7X A;  3F4X A;  3N4B A;  3IGP A;  2HFX A;  3M5T A;  4CA2 A;  1I91 A;  3OY0 A;  1LG5 A;  3SBH A;  3UYN A;  4E3G A;  2EU3 A;  1EOU A;  1RJ6 A;  3L14 A;  2W2J A;  1YDA A;  1TEQ X;  2CAB A;  2QO8 A;  2WEH A;  2FNK A;  1RZC A;  2WD2 A;  2GD8 A;  3M14 A;  3F7B A;  1XEV A;  1YO1 A;  1URT A;  1CZM A;  1LGD A;  2NMX A;  1THK A;  3B4F A;  1CVD A;  2HFY A;  3M5S A;  1I90 A;  4IDR X;  1CAN A;  2HOC A;  1HEC A;  3FW3 A;  2H4N A;  2POV A;  3M40 A;  1CRM A;  3TVN X;  1HVA A;  1G0E A;  1RJ5 A;  3MNJ A;  2HFW A;  1BNN A;  3KKX A;  3R16 A;  3FE4 A;  1RZB A;  3EFI A;  1CNW A;  2NWY A;  3DCW A;  2VVB X;  2Q38 A;  1TEU X;  3V3F A;  1YO0 A;  1JV0 A;  1BNU A;  3DCS A;  1FLJ A;  1CVE A;  3P4V A;  1V9I C;  1CAM A;  5CA2 A;  1KWR A;  1H4N A;  1HED A;  1AVN A;  1CVB A;  3M1K A;  1G0F A;  3RZ7 A;  2NNO A;  1I9Q A;  5CAC A;  1BNM A;  1Z97 A;  3GZ0 A;  1RZA A;  1G4O A;  3D9Z A;  3S77 B;  3W6H A;  3IBU A;  1Z93 A;  3P5L A;  1BNT A;  3RYV B;  1FR7 A;  4CAC A;  3T83 A;  3M67 A;  1CAL A;  3M1Q A;  3MMF A;  2QP6 A;  3MHL A;  1OKN A;  2FW4 A;  1CIN A;  1IF8 A;  3M1J A;  2NN1 A;  1CA2 A;  3MNH A;  1I9P A;  1JCZ A;  1KWQ A;  3UYQ A;  3P44 A;  1TG3 A;  3RJ7 A;  2NNG A;  1CNX A;  3SBI A;  3TMJ A;  3DD0 A;  1LG6 A;  3D0N A;  3ML5 A;  3D8W A;  1CVC A;  3CAJ A;  1FSQ A;  2FOQ A;  3RYZ A;  3T82 A;  2H15 A;  1CAK A;  2NN7 A;  3P58 A;  3RZ8 A;  3B1B A;  2FMZ A;  3MHM A;  3HFP A;  1CIM A;  1IF9 A;  3MNI A;  2NXT A;  3R17 B;  3MHI A;  3DBU A;  2NXS A;  3NI5 A;  2HL4 A;  3U47 A;  3OYS A;  1BNQ A;  3D92 A;  1CNJ A;  3MZC A;  3VBD A;  3DD8 A;  2OSF A;  4E3H A;  1FSR A;  1ZGE A;  3T85 A;  3DVD A;  2X7U A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  1CCS A;  2OSM A;  1RAZ A;  1CIL A;  2FOU A;  1DCA A;  1I9O A;  1RZE A;  3OIK A;  3M2Z A;  3S75 B;  1DMX A;  1KEQ A;  3JXG A;  1V9E A;  3D93 A;  1JD0 A;  6CA2 A;  3S8X A;  3DAZ A;  1TTM A; 
#chains in the KnotProt database with same CATH topology
 1Z9Y A;  2X7S A;  3N3J A;  1CCU A;  3F7U A;  2FMG A;  3BL1 A;  1HEA A;  1FSN A;  2FOS A;  3KS3 A;  1ZGF A;  3T84 A;  3DVC A;  2CBA A;  2X7T A;  1CAI A;  3V3J A;  3TVO X;  3MHO A;  3RG3 A;  1RAY A;  1BN3 A;  1OQ5 A;  1AM6 A;  1I9N A;  1RZD A;  3S9T A;  1H9Q A;  3S76 A;  4FL7 A;  1MUA A;  3KOI A;  1DMY A;  1FQR A;  1FR4 A;  3S73 B;  1BNW A;  3P55 A;  1KOQ A;  1XEG A;  9CA2 A;  3PJJ A;  4E3F A;  1CAO A;  1CCT A;  3BL0 A;  1HEB A;  1OKM A;  3DV7 A;  3DVB A;  3IBN A;  1CAH A;  3NB5 A;  3RZ5 A;  1UGE A;  3BET A;  3DC9 A;  1BV3 A;  3OKV A;  3QYK A;  2F14 A;  3M2X A;  4G0C A;  2NNV A;  1I9M A;  3M5E A;  2Q1Q A;  4E49 A;  1BNV A;  1BZM A;  2FOY A;  3MNU A;  3N0N A;  3K34 A;  3CZV A;  2AX2 A;  1UGC A;  1XPZ A;  3V3H B;  1OKL A;  3DC3 A;  3HS4 A;  3MNA A;  1UGD A;  3U45 X;  3CA2 A;  2NWP A;  2HD6 A;  3ML2 A;  1BN1 A;  3RZ1 B;  1HCA A;  3OKU A;  3KON A;  3P3J A;  4E3D A;  3JXH C;  3M2Y A;  1TH9 A;  1I9L A;  2POW A;  1LUG A;  3IAI A;  3K7K A;  3HKQ A;  1A42 A;  1ZH9 A;  3ZNC A;  1FQN A;  2AW1 A;  3N2P A;  1TE3 X;  2QOA A;  1UGB A;  1CNB A;  1H9N A;  3IBL A;  3RYY A;  2CA2 A;  1IF4 A;  1DCB A;  2WEO A;  2FNN A;  1G3Z A;  2VVA X;  1ZNC A;  1G48 A;  1G45 A;  1ZSA A;  3OYQ A;  1Y7W A;  3F8E A;  1J9W A;  3S71 B;  3KIG A;  3M3X A;  3LXE A;  4BCW A;  3RZ0 B;  3SAP A;  3V3I B;  1UGA A;  1CNC A;  2IT4 A;  3RG4 A;  2CBE A;  1CAZ A;  1IF5 A;  3S78 B;  3DA2 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  1ZFK A;  3PYK A;  1ZSB A;  2WEG A;  3S74 B;  3CYU A;  4FIK A;  3M98 A;  3HKT A;  3MDZ A;  1AZM A;  2HNC A;  1G1D A;  1CVH A;  2POU A;  1F2W A;  3V5G A;  3OIM A;  1HUG A;  3EFT A;  1G54 A;  3FFP X;  3W6I A;  2CBC A;  1TB0 X;  3HLJ A;  1CA3 A;  8CA2 A;  1XQ0 A;  3KNE A;  2ILI A;  1YDB A;  1TG9 A;  2CBD A;  1CAY A;  1IF6 A;  3SAX A;  3V3G B;  1CNK A;  2O4Z A;  3M96 A;  4E4A A;  1ZSC A;  3KOK A;  3IQK A;  2NWZ A;  2EZ7 A;  3HKU A;  1I8Z A;  3C7P A;  3T5Z A;  1TBT X;  1LZV A;  1ZE8 A;  3M04 A;  1ZFQ A;  2FOV A;  2NXR A;  3OIL A;  1HUH A;  3U7C A;  1G53 A;  1FQM A;  2CBB A;  2Q1B A;  1MOO A;  3K2F A;  1UGG A;  1CNY A;  2NWO A;  3MHC A;  1YDC A;  3RLD A;  3RYX B;  1CRA A;  3MNK A;  3IEO A;  1IF7 A;  3U3A X;  1HCB A;  2WEJ A;  2FNM A;  3MWO A;  1CNH A;  1BIC A;  7CA2 A;  3RGE A;  3V2J A;  1G4J A;  3PO6 A;  1G6V A;  3RYJ B;  2ABE A;  1CVF A;  2GEH A;  2NNS A;  3MYQ A;  1CNG A;  3NJ9 A;  1CVA A;  1G52 A;  3IBI A;  2EU2 A;  3KWA A;  1UGF A;  4ILX A;  3DCC A;  3T5U A;  3P3H A;  2WD3 A;  1BCD A;  1CNI A;  1T9N A;  1FQL A;  3M2N A;  1BN4 A;  3S72 B;  3P5A A;  3V2M A;  1YO2 A;  3JXF A;  3V7X A;  3F4X A;  3N4B A;  3IGP A;  2HFX A;  3M5T A;  4CA2 A;  1I91 A;  3OY0 A;  1LG5 A;  3SBH A;  3UYN A;  4E3G A;  2EU3 A;  1EOU A;  1RJ6 A;  3L14 A;  2W2J A;  1YDA A;  1TEQ X;  2CAB A;  2QO8 A;  2WEH A;  2FNK A;  1RZC A;  2WD2 A;  2GD8 A;  3M14 A;  3F7B A;  1XEV A;  1YO1 A;  1URT A;  1CZM A;  1LGD A;  2NMX A;  1THK A;  3B4F A;  1CVD A;  2HFY A;  3M5S A;  1I90 A;  4IDR X;  1CAN A;  2HOC A;  1HEC A;  3FW3 A;  2H4N A;  2POV A;  3M40 A;  1CRM A;  3TVN X;  1HVA A;  1G0E A;  1RJ5 A;  3MNJ A;  2HFW A;  1BNN A;  3KKX A;  3R16 A;  3FE4 A;  1RZB A;  3EFI A;  1CNW A;  2NWY A;  3DCW A;  2VVB X;  2Q38 A;  1TEU X;  3V3F A;  1YO0 A;  1JV0 A;  1BNU A;  3DCS A;  1FLJ A;  1CVE A;  3P4V A;  1V9I C;  1CAM A;  5CA2 A;  1KWR A;  1H4N A;  1HED A;  1AVN A;  1CVB A;  3M1K A;  1G0F A;  3RZ7 A;  2NNO A;  1I9Q A;  5CAC A;  1BNM A;  1Z97 A;  3GZ0 A;  1RZA A;  1G4O A;  3D9Z A;  3S77 B;  3W6H A;  3IBU A;  1Z93 A;  3P5L A;  1BNT A;  3RYV B;  1FR7 A;  4CAC A;  3T83 A;  3M67 A;  1CAL A;  3M1Q A;  3MMF A;  2QP6 A;  3MHL A;  1OKN A;  2FW4 A;  1CIN A;  1IF8 A;  3M1J A;  2NN1 A;  1CA2 A;  3MNH A;  1I9P A;  1JCZ A;  1KWQ A;  3UYQ A;  3P44 A;  1TG3 A;  3RJ7 A;  2NNG A;  1CNX A;  3SBI A;  3TMJ A;  3DD0 A;  1LG6 A;  3D0N A;  3ML5 A;  3D8W A;  1CVC A;  3CAJ A;  1FSQ A;  2FOQ A;  3RYZ A;  3T82 A;  2H15 A;  1CAK A;  2NN7 A;  3P58 A;  3RZ8 A;  3B1B A;  2FMZ A;  3MHM A;  3HFP A;  1CIM A;  1IF9 A;  3MNI A;  2NXT A;  3R17 B;  3MHI A;  3DBU A;  2NXS A;  3NI5 A;  2HL4 A;  3U47 A;  3OYS A;  1BNQ A;  3D92 A;  1CNJ A;  3MZC A;  3VBD A;  3DD8 A;  2OSF A;  4E3H A;  1FSR A;  1ZGE A;  3T85 A;  3DVD A;  2X7U A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  1CCS A;  2OSM A;  1RAZ A;  1CIL A;  2FOU A;  1DCA A;  1I9O A;  1RZE A;  3OIK A;  3M2Z A;  3S75 B;  1DMX A;  1KEQ A;  3JXG A;  1V9E A;  3D93 A;  1JD0 A;  6CA2 A;  3S8X A;  3DAZ A;  1TTM A; 
#chains in the KnotProt database with same CATH homology
 1Z9Y A;  2X7S A;  3N3J A;  1CCU A;  3F7U A;  2FMG A;  3BL1 A;  1HEA A;  1FSN A;  2FOS A;  3KS3 A;  1ZGF A;  3T84 A;  3DVC A;  2CBA A;  2X7T A;  1CAI A;  3V3J A;  3TVO X;  3MHO A;  3RG3 A;  1RAY A;  1BN3 A;  1OQ5 A;  1AM6 A;  1I9N A;  1RZD A;  3S9T A;  1H9Q A;  3S76 A;  4FL7 A;  1MUA A;  3KOI A;  1DMY A;  1FQR A;  1FR4 A;  3S73 B;  1BNW A;  3P55 A;  1KOQ A;  1XEG A;  9CA2 A;  3PJJ A;  4E3F A;  1CAO A;  1CCT A;  3BL0 A;  1HEB A;  1OKM A;  3DV7 A;  3DVB A;  3IBN A;  1CAH A;  3NB5 A;  3RZ5 A;  1UGE A;  3BET A;  3DC9 A;  1BV3 A;  3OKV A;  3QYK A;  2F14 A;  3M2X A;  4G0C A;  2NNV A;  1I9M A;  3M5E A;  2Q1Q A;  4E49 A;  1BNV A;  1BZM A;  2FOY A;  3MNU A;  3N0N A;  3K34 A;  3CZV A;  2AX2 A;  1UGC A;  1XPZ A;  3V3H B;  1OKL A;  3DC3 A;  3HS4 A;  3MNA A;  1UGD A;  3U45 X;  3CA2 A;  2NWP A;  2HD6 A;  3ML2 A;  1BN1 A;  3RZ1 B;  1HCA A;  3OKU A;  3KON A;  3P3J A;  4E3D A;  3JXH C;  3M2Y A;  1TH9 A;  1I9L A;  2POW A;  1LUG A;  3IAI A;  3K7K A;  3HKQ A;  1A42 A;  1ZH9 A;  3ZNC A;  1FQN A;  2AW1 A;  3N2P A;  1TE3 X;  2QOA A;  1UGB A;  1CNB A;  1H9N A;  3IBL A;  3RYY A;  2CA2 A;  1IF4 A;  1DCB A;  2WEO A;  2FNN A;  1G3Z A;  2VVA X;  1ZNC A;  1G48 A;  1G45 A;  1ZSA A;  3OYQ A;  1Y7W A;  3F8E A;  1J9W A;  3S71 B;  3KIG A;  3M3X A;  3LXE A;  4BCW A;  3RZ0 B;  3SAP A;  3V3I B;  1UGA A;  1CNC A;  2IT4 A;  3RG4 A;  2CBE A;  1CAZ A;  1IF5 A;  3S78 B;  3DA2 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  1ZFK A;  3PYK A;  1ZSB A;  2WEG A;  3S74 B;  3CYU A;  4FIK A;  3M98 A;  3HKT A;  3MDZ A;  1AZM A;  2HNC A;  1G1D A;  1CVH A;  2POU A;  1F2W A;  3V5G A;  3OIM A;  1HUG A;  3EFT A;  1G54 A;  3FFP X;  3W6I A;  2CBC A;  1TB0 X;  3HLJ A;  1CA3 A;  8CA2 A;  1XQ0 A;  3KNE A;  2ILI A;  1YDB A;  1TG9 A;  2CBD A;  1CAY A;  1IF6 A;  3SAX A;  3V3G B;  1CNK A;  2O4Z A;  3M96 A;  4E4A A;  1ZSC A;  3KOK A;  3IQK A;  2NWZ A;  2EZ7 A;  3HKU A;  1I8Z A;  3C7P A;  3T5Z A;  1TBT X;  1LZV A;  1ZE8 A;  3M04 A;  1ZFQ A;  2FOV A;  2NXR A;  3OIL A;  1HUH A;  3U7C A;  1G53 A;  1FQM A;  2CBB A;  2Q1B A;  1MOO A;  3K2F A;  1UGG A;  1CNY A;  2NWO A;  3MHC A;  1YDC A;  3RLD A;  3RYX B;  1CRA A;  3MNK A;  3IEO A;  1IF7 A;  3U3A X;  1HCB A;  2WEJ A;  2FNM A;  3MWO A;  1CNH A;  1BIC A;  7CA2 A;  3RGE A;  3V2J A;  1G4J A;  3PO6 A;  1G6V A;  3RYJ B;  2ABE A;  1CVF A;  2GEH A;  2NNS A;  3MYQ A;  1CNG A;  3NJ9 A;  1CVA A;  1G52 A;  3IBI A;  2EU2 A;  3KWA A;  1UGF A;  4ILX A;  3DCC A;  3T5U A;  3P3H A;  2WD3 A;  1BCD A;  1CNI A;  1T9N A;  1FQL A;  3M2N A;  1BN4 A;  3S72 B;  3P5A A;  3V2M A;  1YO2 A;  3JXF A;  3V7X A;  3F4X A;  3N4B A;  3IGP A;  2HFX A;  3M5T A;  4CA2 A;  1I91 A;  3OY0 A;  1LG5 A;  3SBH A;  3UYN A;  4E3G A;  2EU3 A;  1EOU A;  1RJ6 A;  3L14 A;  2W2J A;  1YDA A;  1TEQ X;  2CAB A;  2QO8 A;  2WEH A;  2FNK A;  1RZC A;  2WD2 A;  2GD8 A;  3M14 A;  3F7B A;  1XEV A;  1YO1 A;  1URT A;  1CZM A;  1LGD A;  2NMX A;  1THK A;  3B4F A;  1CVD A;  2HFY A;  3M5S A;  1I90 A;  4IDR X;  1CAN A;  2HOC A;  1HEC A;  3FW3 A;  2H4N A;  2POV A;  3M40 A;  1CRM A;  3TVN X;  1HVA A;  1G0E A;  1RJ5 A;  3MNJ A;  2HFW A;  1BNN A;  3KKX A;  3R16 A;  3FE4 A;  1RZB A;  3EFI A;  1CNW A;  2NWY A;  3DCW A;  2VVB X;  2Q38 A;  1TEU X;  3V3F A;  1YO0 A;  1JV0 A;  1BNU A;  3DCS A;  1FLJ A;  1CVE A;  3P4V A;  1V9I C;  1CAM A;  5CA2 A;  1KWR A;  1H4N A;  1HED A;  1AVN A;  1CVB A;  3M1K A;  1G0F A;  3RZ7 A;  2NNO A;  1I9Q A;  5CAC A;  1BNM A;  1Z97 A;  3GZ0 A;  1RZA A;  1G4O A;  3D9Z A;  3S77 B;  3W6H A;  3IBU A;  1Z93 A;  3P5L A;  1BNT A;  3RYV B;  1FR7 A;  4CAC A;  3T83 A;  3M67 A;  1CAL A;  3M1Q A;  3MMF A;  2QP6 A;  3MHL A;  1OKN A;  2FW4 A;  1CIN A;  1IF8 A;  3M1J A;  2NN1 A;  1CA2 A;  3MNH A;  1I9P A;  1JCZ A;  1KWQ A;  3UYQ A;  3P44 A;  1TG3 A;  3RJ7 A;  2NNG A;  1CNX A;  3SBI A;  3TMJ A;  3DD0 A;  1LG6 A;  3D0N A;  3ML5 A;  3D8W A;  1CVC A;  3CAJ A;  1FSQ A;  2FOQ A;  3RYZ A;  3T82 A;  2H15 A;  1CAK A;  2NN7 A;  3P58 A;  3RZ8 A;  3B1B A;  2FMZ A;  3MHM A;  3HFP A;  1CIM A;  1IF9 A;  3MNI A;  2NXT A;  3R17 B;  3MHI A;  3DBU A;  2NXS A;  3NI5 A;  2HL4 A;  3U47 A;  3OYS A;  1BNQ A;  3D92 A;  1CNJ A;  3MZC A;  3VBD A;  3DD8 A;  2OSF A;  4E3H A;  1FSR A;  1ZGE A;  3T85 A;  3DVD A;  2X7U A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  1CCS A;  2OSM A;  1RAZ A;  1CIL A;  2FOU A;  1DCA A;  1I9O A;  1RZE A;  3OIK A;  3M2Z A;  3S75 B;  1DMX A;  1KEQ A;  3JXG A;  1V9E A;  3D93 A;  1JD0 A;  6CA2 A;  3S8X A;  3DAZ A;  1TTM A; 
3IQKA
similar chains in the KnotProt database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 3IQK A; 
               
               
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling