2HFYA

Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase iii
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 27-256 230 1-26, 257-259 26 3 knot
Chain Sequence
AKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCHVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSSLFPASRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 24-253 230 1-23 259-259 254-258 23 1 slipknot
view details
2.1 27-256 230 1-23, 258-259 24-26, 257-257 23 2 slipknot
publication title Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase III.
pubmed doi rcsb
structure length 259
molecule tags Lyase
source organism Homo sapiens
sequence length 259
molecule keywords carbonic anhydrase 3
ec nomenclature
pdb deposition date 2006-06-26
KnotProt deposition date 2014-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 2hfyA00
3HFPA 1G45A 2X7SA 1G0EA 1Z97A 1CCTA 2FMGA 8CA2A 1CCUA 3F7UA 1ZSAA 2NXRA 3BL1A 1HEAA 3NJ9A 1CVAA 1FSNA 1G4OA 3IEOA 3DA2A 1G52A 3DVCA 3IBIA 2EU2A 2X7TA 1CAIA 3M2ZA 3C7PA 1Z93A 1Y7WA 3KWAA 1IF5A 1HCBA 3MHOA 3M67A 1J9WA 1FLJA 2EU3A 1I9OA 3DCCA 3CA2A 1BN3A 1BNTA 1TEUX 2FOQA 1AM6A 3M3XA 1I9NA 3F8EA 1CVBA 1BNMA 2FNMA 1I8ZA 1CNIA 3PO6A 3MWOA 4CACA 1LZVA 3GZ0A 1DMYA 1H9QA 1CALA 3M1QA 1CA2A 3M2NA 1YDBA 1UGAA 3MMFA 1MUAA 1CNGA 1CNCA 3MDZA 2IT4A 3NB5A 3K2FA 2FW4A 1FQRA 1FR4A 3JXFA 2CBEA 1IF8A 1BNWA 3KOKA 3M1JA 1KOQA 3F4XA 1IF6A 3N4BA 3MNHA 3IGPA 2HFXA 1XEGA 1JCZA 1CNJA 4CA2A 1I91A 1YDDA 12CAA 2HKKA 1G46A 1TG3A 1CAOA 1IF4A 1UGEA 3KS3A 1ZSBA 3R16A 1HEBA 3MYQA 2NNGA 2HL4A 3B1BA 3KIGA 3CYUA 3DV7A 3B4FA 3DVBA 3IBNA 3M98A 3HKTA 1CAHA 1EOUA 1AZMA 1CNXA 2HNCA 3M40A 1RJ6A 1IF7A 1G1DA 1CVHA 2CBAA 3L14A 1CVDA 2W2JA 2POUA 1YDAA 3MNKA 3FFPX 1LG6A 3DD0A 3DC9A 1BV3A 3K34A 3ML5A 3R17B 3OKVA 1KEQA 2WEHA 2FNKA 1TEQX 3CAJA 1FSQA 3OIMA 1HUGA 3EFTA 1G54A 1FQLA 2GD8A 2CBCA 1TB0X 1CAKA 2F14A 2NN7A 3F7BA 1I90A 1XQ0A 3KNEA 2NNVA 2ILIA 3MHMA 1I9MA 3MHLA 3M5EA 2CABA 2NWYA 1YO1A 1TG9A 1CIMA 2Q1QA 1URTA 2CBDA 1LGDA 1BNVA 2NMXA 2Q1BA 1THKA 3BETA 5CACA 3MNIA 1BZMA 2HFYA 2FOYA 3MNUA 3N0NA 2WD3A 3M5SA 2O4ZA 3D0NA 3MHIA 3M96A 1ZE8A 3CZVA 2H15A 2VVBX 2AX2A 1UGCA 1ZSCA 1I9PA 1XPZA 3DBUA 1HECA 3FW3A 2H4NA 2NXSA 2POVA 3NI5A 3IQKA 2NWZA 2FOVA 1CRMA 3DC3A 1BNQA 3HKUA 3HS4A 1CAYA 3IBUA 3D92A 3MNAA 1RJ5A 3MNJA 1UGDA 1CVFA 1RAYA 2NWPA 2HFWA 1CVCA 3MZCA 2CA2A 3ML2A 3M04A 3KKXA 1BN1A 1HCAA 3OKUA 3KONA 3FE4A 2WEOA 2ABEA 1RZBA 2Q38A 3EFIA 1FSRA 1CNWA 1HUHA 3JXHC 1G53A 3DVDA 2CBBA 3DCWA 1OKMA 1CAJA 3M1WA 3HKNA 2ZNCA 3M2YA 1CCSA 1UGGA 1TH9A 2OSMA 1RAZA 2NWOA 1I9LA 1OQ5A 3MHCA 1JD0A 5CA2A 1YO0A 3IAIA 3K7KA 1CILA 1CA3A 1BNUA 3HKQA 3D9ZA 3DCSA 2FNNA 1DCAA 3LXEA 2WEJA 1CVEA 1RZEA 2POWA 3P4VA 1CNHA 3OIKA 3ZNCA 2OSFA 1FQNA 1V9IC 2AW1A 1CAMA 3N2PA 1YDCA 2FOUA 1TE3X 1KWRA 3HLJA 1UGBA 1H4NA 1HEDA 1IF9A 1FR7A 2EZ7A 1G4JA 3OILA 1H9NA 6CA2A 3JXGA 3IBLA 1G6VA 1V9EA 1HVAA 3M1KA 1G0FA 3D93A 1DCBA 3BL0A 2NNOA 1I9QA 2GEHA 2NNSA 3DAZA 1G3ZA 1TTMA 2VVAX 1ZNCA 2WEGA 1G48A
chains in the KnotProt database with same CATH superfamily
3HFPA 1G45A 2X7SA 1G0EA 1Z97A 1CCTA 2FMGA 8CA2A 1CCUA 3F7UA 1ZSAA 2NXRA 3BL1A 1HEAA 3NJ9A 1CVAA 1FSNA 1G4OA 3IEOA 3DA2A 1G52A 3DVCA 3IBIA 2EU2A 2X7TA 1CAIA 3M2ZA 3C7PA 1Z93A 1Y7WA 3KWAA 1IF5A 1HCBA 3MHOA 3M67A 1J9WA 1FLJA 2EU3A 1I9OA 3DCCA 3CA2A 1BN3A 1BNTA 1TEUX 2FOQA 1AM6A 3M3XA 1I9NA 3F8EA 1CVBA 1BNMA 2FNMA 1I8ZA 1CNIA 3PO6A 3MWOA 4CACA 1LZVA 3GZ0A 1DMYA 1H9QA 1CALA 3M1QA 1CA2A 3M2NA 1YDBA 1UGAA 3MMFA 1MUAA 1CNGA 1CNCA 3MDZA 2IT4A 3NB5A 3K2FA 2FW4A 1FQRA 1FR4A 3JXFA 2CBEA 1IF8A 1BNWA 3KOKA 3M1JA 1KOQA 3F4XA 1IF6A 3N4BA 3MNHA 3IGPA 2HFXA 1XEGA 1JCZA 1CNJA 4CA2A 1I91A 1YDDA 12CAA 2HKKA 1G46A 1TG3A 1CAOA 1IF4A 1UGEA 3KS3A 1ZSBA 3R16A 1HEBA 3MYQA 2NNGA 2HL4A 3B1BA 3KIGA 3CYUA 3DV7A 3B4FA 3DVBA 3IBNA 3M98A 3HKTA 1CAHA 1EOUA 1AZMA 1CNXA 2HNCA 3M40A 1RJ6A 1IF7A 1G1DA 1CVHA 2CBAA 3L14A 1CVDA 2W2JA 2POUA 1YDAA 3MNKA 3FFPX 1LG6A 3DD0A 3DC9A 1BV3A 3K34A 3ML5A 3R17B 3OKVA 1KEQA 2WEHA 2FNKA 1TEQX 3CAJA 1FSQA 3OIMA 1HUGA 3EFTA 1G54A 1FQLA 2GD8A 2CBCA 1TB0X 1CAKA 2F14A 2NN7A 3F7BA 1I90A 1XQ0A 3KNEA 2NNVA 2ILIA 3MHMA 1I9MA 3MHLA 3M5EA 2CABA 2NWYA 1YO1A 1TG9A 1CIMA 2Q1QA 1URTA 2CBDA 1LGDA 1BNVA 2NMXA 2Q1BA 1THKA 3BETA 5CACA 3MNIA 1BZMA 2HFYA 2FOYA 3MNUA 3N0NA 2WD3A 3M5SA 2O4ZA 3D0NA 3MHIA 3M96A 1ZE8A 3CZVA 2H15A 2VVBX 2AX2A 1UGCA 1ZSCA 1I9PA 1XPZA 3DBUA 1HECA 3FW3A 2H4NA 2NXSA 2POVA 3NI5A 3IQKA 2NWZA 2FOVA 1CRMA 3DC3A 1BNQA 3HKUA 3HS4A 1CAYA 3IBUA 3D92A 3MNAA 1RJ5A 3MNJA 1UGDA 1CVFA 1RAYA 2NWPA 2HFWA 1CVCA 3MZCA 2CA2A 3ML2A 3M04A 3KKXA 1BN1A 1HCAA 3OKUA 3KONA 3FE4A 2WEOA 2ABEA 1RZBA 2Q38A 3EFIA 1FSRA 1CNWA 1HUHA 3JXHC 1G53A 3DVDA 2CBBA 3DCWA 1OKMA 1CAJA 3M1WA 3HKNA 2ZNCA 3M2YA 1CCSA 1UGGA 1TH9A 2OSMA 1RAZA 2NWOA 1I9LA 1OQ5A 3MHCA 1JD0A 5CA2A 1YO0A 3IAIA 3K7KA 1CILA 1CA3A 1BNUA 3HKQA 3D9ZA 3DCSA 2FNNA 1DCAA 3LXEA 2WEJA 1CVEA 1RZEA 2POWA 3P4VA 1CNHA 3OIKA 3ZNCA 2OSFA 1FQNA 1V9IC 2AW1A 1CAMA 3N2PA 1YDCA 2FOUA 1TE3X 1KWRA 3HLJA 1UGBA 1H4NA 1HEDA 1IF9A 1FR7A 2EZ7A 1G4JA 3OILA 1H9NA 6CA2A 3JXGA 3IBLA 1G6VA 1V9EA 1HVAA 3M1KA 1G0FA 3D93A 1DCBA 3BL0A 2NNOA 1I9QA 2GEHA 2NNSA 3DAZA 1G3ZA 1TTMA 2VVAX 1ZNCA 2WEGA 1G48A
chains in the KnotProt database with same CATH topology
3HFPA 1G45A 2X7SA 1G0EA 1Z97A 1CCTA 2FMGA 8CA2A 1CCUA 3F7UA 1ZSAA 2NXRA 3BL1A 1HEAA 3NJ9A 1CVAA 1FSNA 1G4OA 3IEOA 3DA2A 1G52A 3DVCA 3IBIA 2EU2A 2X7TA 1CAIA 3M2ZA 3C7PA 1Z93A 1Y7WA 3KWAA 1IF5A 1HCBA 3MHOA 3M67A 1J9WA 1FLJA 2EU3A 1I9OA 3DCCA 3CA2A 1BN3A 1BNTA 1TEUX 2FOQA 1AM6A 3M3XA 1I9NA 3F8EA 1CVBA 1BNMA 2FNMA 1I8ZA 1CNIA 3PO6A 3MWOA 4CACA 1LZVA 3GZ0A 1DMYA 1H9QA 1CALA 3M1QA 1CA2A 3M2NA 1YDBA 1UGAA 3MMFA 1MUAA 1CNGA 1CNCA 3MDZA 2IT4A 3NB5A 3K2FA 2FW4A 1FQRA 1FR4A 3JXFA 2CBEA 1IF8A 1BNWA 3KOKA 3M1JA 1KOQA 3F4XA 1IF6A 3N4BA 3MNHA 3IGPA 2HFXA 1XEGA 1JCZA 1CNJA 4CA2A 1I91A 1YDDA 12CAA 2HKKA 1G46A 1TG3A 1CAOA 1IF4A 1UGEA 3KS3A 1ZSBA 3R16A 1HEBA 3MYQA 2NNGA 2HL4A 3B1BA 3KIGA 3CYUA 3DV7A 3B4FA 3DVBA 3IBNA 3M98A 3HKTA 1CAHA 1EOUA 1AZMA 1CNXA 2HNCA 3M40A 1RJ6A 1IF7A 1G1DA 1CVHA 2CBAA 3L14A 1CVDA 2W2JA 2POUA 1YDAA 3MNKA 3FFPX 1LG6A 3DD0A 3DC9A 1BV3A 3K34A 3ML5A 3R17B 3OKVA 1KEQA 2WEHA 2FNKA 1TEQX 3CAJA 1FSQA 3OIMA 1HUGA 3EFTA 1G54A 1FQLA 2GD8A 2CBCA 1TB0X 1CAKA 2F14A 2NN7A 3F7BA 1I90A 1XQ0A 3KNEA 2NNVA 2ILIA 3MHMA 1I9MA 3MHLA 3M5EA 2CABA 2NWYA 1YO1A 1TG9A 1CIMA 2Q1QA 1URTA 2CBDA 1LGDA 1BNVA 2NMXA 2Q1BA 1THKA 3BETA 5CACA 3MNIA 1BZMA 2HFYA 2FOYA 3MNUA 3N0NA 2WD3A 3M5SA 2O4ZA 3D0NA 3MHIA 3M96A 1ZE8A 3CZVA 2H15A 2VVBX 2AX2A 1UGCA 1ZSCA 1I9PA 1XPZA 3DBUA 1HECA 3FW3A 2H4NA 2NXSA 2POVA 3NI5A 3IQKA 2NWZA 2FOVA 1CRMA 3DC3A 1BNQA 3HKUA 3HS4A 1CAYA 3IBUA 3D92A 3MNAA 1RJ5A 3MNJA 1UGDA 1CVFA 1RAYA 2NWPA 2HFWA 1CVCA 3MZCA 2CA2A 3ML2A 3M04A 3KKXA 1BN1A 1HCAA 3OKUA 3KONA 3FE4A 2WEOA 2ABEA 1RZBA 2Q38A 3EFIA 1FSRA 1CNWA 1HUHA 3JXHC 1G53A 3DVDA 2CBBA 3DCWA 1OKMA 1CAJA 3M1WA 3HKNA 2ZNCA 3M2YA 1CCSA 1UGGA 1TH9A 2OSMA 1RAZA 2NWOA 1I9LA 1OQ5A 3MHCA 1JD0A 5CA2A 1YO0A 3IAIA 3K7KA 1CILA 1CA3A 1BNUA 3HKQA 3D9ZA 3DCSA 2FNNA 1DCAA 3LXEA 2WEJA 1CVEA 1RZEA 2POWA 3P4VA 1CNHA 3OIKA 3ZNCA 2OSFA 1FQNA 1V9IC 2AW1A 1CAMA 3N2PA 1YDCA 2FOUA 1TE3X 1KWRA 3HLJA 1UGBA 1H4NA 1HEDA 1IF9A 1FR7A 2EZ7A 1G4JA 3OILA 1H9NA 6CA2A 3JXGA 3IBLA 1G6VA 1V9EA 1HVAA 3M1KA 1G0FA 3D93A 1DCBA 3BL0A 2NNOA 1I9QA 2GEHA 2NNSA 3DAZA 1G3ZA 1TTMA 2VVAX 1ZNCA 2WEGA 1G48A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3HFP A;  1G45 A;  2X7S A;  1G0E A;  1Z97 A;  1CCT A;  2FMG A;  8CA2 A;  1CCU A;  3F7U A;  1ZSA A;  2NXR A;  3BL1 A;  1HEA A;  3NJ9 A;  1CVA A;  1FSN A;  1G4O A;  3IEO A;  3DA2 A;  1G52 A;  3DVC A;  3IBI A;  2EU2 A;  2X7T A;  1CAI A;  3M2Z A;  3C7P A;  1Z93 A;  1Y7W A;  3KWA A;  1IF5 A;  1HCB A;  3MHO A;  3M67 A;  1J9W A;  1FLJ A;  2EU3 A;  1I9O A;  3DCC A;  3CA2 A;  1BN3 A;  1BNT A;  1TEU X;  2FOQ A;  1AM6 A;  3M3X A;  1I9N A;  3F8E A;  1CVB A;  1BNM A;  2FNM A;  1I8Z A;  1CNI A;  3PO6 A;  3MWO A;  4CAC A;  1LZV A;  3GZ0 A;  1DMY A;  1H9Q A;  1CAL A;  3M1Q A;  1CA2 A;  3M2N A;  1YDB A;  1UGA A;  3MMF A;  1MUA A;  1CNG A;  1CNC A;  3MDZ A;  2IT4 A;  3NB5 A;  3K2F A;  2FW4 A;  1FQR A;  1FR4 A;  3JXF A;  2CBE A;  1IF8 A;  1BNW A;  3KOK A;  3M1J A;  1KOQ A;  3F4X A;  1IF6 A;  3N4B A;  3MNH A;  3IGP A;  2HFX A;  1XEG A;  1JCZ A;  1CNJ A;  4CA2 A;  1I91 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  1TG3 A;  1CAO A;  1IF4 A;  1UGE A;  3KS3 A;  1ZSB A;  3R16 A;  1HEB A;  3MYQ A;  2NNG A;  2HL4 A;  3B1B A;  3KIG A;  3CYU A;  3DV7 A;  3B4F A;  3DVB A;  3IBN A;  3M98 A;  3HKT A;  1CAH A;  1EOU A;  1AZM A;  1CNX A;  2HNC A;  3M40 A;  1RJ6 A;  1IF7 A;  1G1D A;  1CVH A;  2CBA A;  3L14 A;  1CVD A;  2W2J A;  2POU A;  1YDA A;  3MNK A;  3FFP X;  1LG6 A;  3DD0 A;  3DC9 A;  1BV3 A;  3K34 A;  3ML5 A;  3R17 B;  3OKV A;  1KEQ A;  2WEH A;  2FNK A;  1TEQ X;  3CAJ A;  1FSQ A;  3OIM A;  1HUG A;  3EFT A;  1G54 A;  1FQL A;  2GD8 A;  2CBC A;  1TB0 X;  1CAK A;  2F14 A;  2NN7 A;  3F7B A;  1I90 A;  1XQ0 A;  3KNE A;  2NNV A;  2ILI A;  3MHM A;  1I9M A;  3MHL A;  3M5E A;  2CAB A;  2NWY A;  1YO1 A;  1TG9 A;  1CIM A;  2Q1Q A;  1URT A;  2CBD A;  1LGD A;  1BNV A;  2NMX A;  2Q1B A;  1THK A;  3BET A;  5CAC A;  3MNI A;  1BZM A;  2HFY A;  2FOY A;  3MNU A;  3N0N A;  2WD3 A;  3M5S A;  2O4Z A;  3D0N A;  3MHI A;  3M96 A;  1ZE8 A;  3CZV A;  2H15 A;  2VVB X;  2AX2 A;  1UGC A;  1ZSC A;  1I9P A;  1XPZ A;  3DBU A;  1HEC A;  3FW3 A;  2H4N A;  2NXS A;  2POV A;  3NI5 A;  3IQK A;  2NWZ A;  2FOV A;  1CRM A;  3DC3 A;  1BNQ A;  3HKU A;  3HS4 A;  1CAY A;  3IBU A;  3D92 A;  3MNA A;  1RJ5 A;  3MNJ A;  1UGD A;  1CVF A;  1RAY A;  2NWP A;  2HFW A;  1CVC A;  3MZC A;  2CA2 A;  3ML2 A;  3M04 A;  3KKX A;  1BN1 A;  1HCA A;  3OKU A;  3KON A;  3FE4 A;  2WEO A;  2ABE A;  1RZB A;  2Q38 A;  3EFI A;  1FSR A;  1CNW A;  1HUH A;  3JXH C;  1G53 A;  3DVD A;  2CBB A;  3DCW A;  1OKM A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  3M2Y A;  1CCS A;  1UGG A;  1TH9 A;  2OSM A;  1RAZ A;  2NWO A;  1I9L A;  1OQ5 A;  3MHC A;  1JD0 A;  5CA2 A;  1YO0 A;  3IAI A;  3K7K A;  1CIL A;  1CA3 A;  1BNU A;  3HKQ A;  3D9Z A;  3DCS A;  2FNN A;  1DCA A;  3LXE A;  2WEJ A;  1CVE A;  1RZE A;  2POW A;  3P4V A;  1CNH A;  3OIK A;  3ZNC A;  2OSF A;  1FQN A;  1V9I C;  2AW1 A;  1CAM A;  3N2P A;  1YDC A;  2FOU A;  1TE3 X;  1KWR A;  3HLJ A;  1UGB A;  1H4N A;  1HED A;  1IF9 A;  1FR7 A;  2EZ7 A;  1G4J A;  3OIL A;  1H9N A;  6CA2 A;  3JXG A;  3IBL A;  1G6V A;  1V9E A;  1HVA A;  3M1K A;  1G0F A;  3D93 A;  1DCB A;  3BL0 A;  2NNO A;  1I9Q A;  2GEH A;  2NNS A;  3DAZ A;  1G3Z A;  1TTM A;  2VVA X;  1ZNC A;  2WEG A;  1G48 A; 
#chains in the KnotProt database with same CATH topology
 3HFP A;  1G45 A;  2X7S A;  1G0E A;  1Z97 A;  1CCT A;  2FMG A;  8CA2 A;  1CCU A;  3F7U A;  1ZSA A;  2NXR A;  3BL1 A;  1HEA A;  3NJ9 A;  1CVA A;  1FSN A;  1G4O A;  3IEO A;  3DA2 A;  1G52 A;  3DVC A;  3IBI A;  2EU2 A;  2X7T A;  1CAI A;  3M2Z A;  3C7P A;  1Z93 A;  1Y7W A;  3KWA A;  1IF5 A;  1HCB A;  3MHO A;  3M67 A;  1J9W A;  1FLJ A;  2EU3 A;  1I9O A;  3DCC A;  3CA2 A;  1BN3 A;  1BNT A;  1TEU X;  2FOQ A;  1AM6 A;  3M3X A;  1I9N A;  3F8E A;  1CVB A;  1BNM A;  2FNM A;  1I8Z A;  1CNI A;  3PO6 A;  3MWO A;  4CAC A;  1LZV A;  3GZ0 A;  1DMY A;  1H9Q A;  1CAL A;  3M1Q A;  1CA2 A;  3M2N A;  1YDB A;  1UGA A;  3MMF A;  1MUA A;  1CNG A;  1CNC A;  3MDZ A;  2IT4 A;  3NB5 A;  3K2F A;  2FW4 A;  1FQR A;  1FR4 A;  3JXF A;  2CBE A;  1IF8 A;  1BNW A;  3KOK A;  3M1J A;  1KOQ A;  3F4X A;  1IF6 A;  3N4B A;  3MNH A;  3IGP A;  2HFX A;  1XEG A;  1JCZ A;  1CNJ A;  4CA2 A;  1I91 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  1TG3 A;  1CAO A;  1IF4 A;  1UGE A;  3KS3 A;  1ZSB A;  3R16 A;  1HEB A;  3MYQ A;  2NNG A;  2HL4 A;  3B1B A;  3KIG A;  3CYU A;  3DV7 A;  3B4F A;  3DVB A;  3IBN A;  3M98 A;  3HKT A;  1CAH A;  1EOU A;  1AZM A;  1CNX A;  2HNC A;  3M40 A;  1RJ6 A;  1IF7 A;  1G1D A;  1CVH A;  2CBA A;  3L14 A;  1CVD A;  2W2J A;  2POU A;  1YDA A;  3MNK A;  3FFP X;  1LG6 A;  3DD0 A;  3DC9 A;  1BV3 A;  3K34 A;  3ML5 A;  3R17 B;  3OKV A;  1KEQ A;  2WEH A;  2FNK A;  1TEQ X;  3CAJ A;  1FSQ A;  3OIM A;  1HUG A;  3EFT A;  1G54 A;  1FQL A;  2GD8 A;  2CBC A;  1TB0 X;  1CAK A;  2F14 A;  2NN7 A;  3F7B A;  1I90 A;  1XQ0 A;  3KNE A;  2NNV A;  2ILI A;  3MHM A;  1I9M A;  3MHL A;  3M5E A;  2CAB A;  2NWY A;  1YO1 A;  1TG9 A;  1CIM A;  2Q1Q A;  1URT A;  2CBD A;  1LGD A;  1BNV A;  2NMX A;  2Q1B A;  1THK A;  3BET A;  5CAC A;  3MNI A;  1BZM A;  2HFY A;  2FOY A;  3MNU A;  3N0N A;  2WD3 A;  3M5S A;  2O4Z A;  3D0N A;  3MHI A;  3M96 A;  1ZE8 A;  3CZV A;  2H15 A;  2VVB X;  2AX2 A;  1UGC A;  1ZSC A;  1I9P A;  1XPZ A;  3DBU A;  1HEC A;  3FW3 A;  2H4N A;  2NXS A;  2POV A;  3NI5 A;  3IQK A;  2NWZ A;  2FOV A;  1CRM A;  3DC3 A;  1BNQ A;  3HKU A;  3HS4 A;  1CAY A;  3IBU A;  3D92 A;  3MNA A;  1RJ5 A;  3MNJ A;  1UGD A;  1CVF A;  1RAY A;  2NWP A;  2HFW A;  1CVC A;  3MZC A;  2CA2 A;  3ML2 A;  3M04 A;  3KKX A;  1BN1 A;  1HCA A;  3OKU A;  3KON A;  3FE4 A;  2WEO A;  2ABE A;  1RZB A;  2Q38 A;  3EFI A;  1FSR A;  1CNW A;  1HUH A;  3JXH C;  1G53 A;  3DVD A;  2CBB A;  3DCW A;  1OKM A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  3M2Y A;  1CCS A;  1UGG A;  1TH9 A;  2OSM A;  1RAZ A;  2NWO A;  1I9L A;  1OQ5 A;  3MHC A;  1JD0 A;  5CA2 A;  1YO0 A;  3IAI A;  3K7K A;  1CIL A;  1CA3 A;  1BNU A;  3HKQ A;  3D9Z A;  3DCS A;  2FNN A;  1DCA A;  3LXE A;  2WEJ A;  1CVE A;  1RZE A;  2POW A;  3P4V A;  1CNH A;  3OIK A;  3ZNC A;  2OSF A;  1FQN A;  1V9I C;  2AW1 A;  1CAM A;  3N2P A;  1YDC A;  2FOU A;  1TE3 X;  1KWR A;  3HLJ A;  1UGB A;  1H4N A;  1HED A;  1IF9 A;  1FR7 A;  2EZ7 A;  1G4J A;  3OIL A;  1H9N A;  6CA2 A;  3JXG A;  3IBL A;  1G6V A;  1V9E A;  1HVA A;  3M1K A;  1G0F A;  3D93 A;  1DCB A;  3BL0 A;  2NNO A;  1I9Q A;  2GEH A;  2NNS A;  3DAZ A;  1G3Z A;  1TTM A;  2VVA X;  1ZNC A;  2WEG A;  1G48 A; 
#chains in the KnotProt database with same CATH homology
 3HFP A;  1G45 A;  2X7S A;  1G0E A;  1Z97 A;  1CCT A;  2FMG A;  8CA2 A;  1CCU A;  3F7U A;  1ZSA A;  2NXR A;  3BL1 A;  1HEA A;  3NJ9 A;  1CVA A;  1FSN A;  1G4O A;  3IEO A;  3DA2 A;  1G52 A;  3DVC A;  3IBI A;  2EU2 A;  2X7T A;  1CAI A;  3M2Z A;  3C7P A;  1Z93 A;  1Y7W A;  3KWA A;  1IF5 A;  1HCB A;  3MHO A;  3M67 A;  1J9W A;  1FLJ A;  2EU3 A;  1I9O A;  3DCC A;  3CA2 A;  1BN3 A;  1BNT A;  1TEU X;  2FOQ A;  1AM6 A;  3M3X A;  1I9N A;  3F8E A;  1CVB A;  1BNM A;  2FNM A;  1I8Z A;  1CNI A;  3PO6 A;  3MWO A;  4CAC A;  1LZV A;  3GZ0 A;  1DMY A;  1H9Q A;  1CAL A;  3M1Q A;  1CA2 A;  3M2N A;  1YDB A;  1UGA A;  3MMF A;  1MUA A;  1CNG A;  1CNC A;  3MDZ A;  2IT4 A;  3NB5 A;  3K2F A;  2FW4 A;  1FQR A;  1FR4 A;  3JXF A;  2CBE A;  1IF8 A;  1BNW A;  3KOK A;  3M1J A;  1KOQ A;  3F4X A;  1IF6 A;  3N4B A;  3MNH A;  3IGP A;  2HFX A;  1XEG A;  1JCZ A;  1CNJ A;  4CA2 A;  1I91 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  1TG3 A;  1CAO A;  1IF4 A;  1UGE A;  3KS3 A;  1ZSB A;  3R16 A;  1HEB A;  3MYQ A;  2NNG A;  2HL4 A;  3B1B A;  3KIG A;  3CYU A;  3DV7 A;  3B4F A;  3DVB A;  3IBN A;  3M98 A;  3HKT A;  1CAH A;  1EOU A;  1AZM A;  1CNX A;  2HNC A;  3M40 A;  1RJ6 A;  1IF7 A;  1G1D A;  1CVH A;  2CBA A;  3L14 A;  1CVD A;  2W2J A;  2POU A;  1YDA A;  3MNK A;  3FFP X;  1LG6 A;  3DD0 A;  3DC9 A;  1BV3 A;  3K34 A;  3ML5 A;  3R17 B;  3OKV A;  1KEQ A;  2WEH A;  2FNK A;  1TEQ X;  3CAJ A;  1FSQ A;  3OIM A;  1HUG A;  3EFT A;  1G54 A;  1FQL A;  2GD8 A;  2CBC A;  1TB0 X;  1CAK A;  2F14 A;  2NN7 A;  3F7B A;  1I90 A;  1XQ0 A;  3KNE A;  2NNV A;  2ILI A;  3MHM A;  1I9M A;  3MHL A;  3M5E A;  2CAB A;  2NWY A;  1YO1 A;  1TG9 A;  1CIM A;  2Q1Q A;  1URT A;  2CBD A;  1LGD A;  1BNV A;  2NMX A;  2Q1B A;  1THK A;  3BET A;  5CAC A;  3MNI A;  1BZM A;  2HFY A;  2FOY A;  3MNU A;  3N0N A;  2WD3 A;  3M5S A;  2O4Z A;  3D0N A;  3MHI A;  3M96 A;  1ZE8 A;  3CZV A;  2H15 A;  2VVB X;  2AX2 A;  1UGC A;  1ZSC A;  1I9P A;  1XPZ A;  3DBU A;  1HEC A;  3FW3 A;  2H4N A;  2NXS A;  2POV A;  3NI5 A;  3IQK A;  2NWZ A;  2FOV A;  1CRM A;  3DC3 A;  1BNQ A;  3HKU A;  3HS4 A;  1CAY A;  3IBU A;  3D92 A;  3MNA A;  1RJ5 A;  3MNJ A;  1UGD A;  1CVF A;  1RAY A;  2NWP A;  2HFW A;  1CVC A;  3MZC A;  2CA2 A;  3ML2 A;  3M04 A;  3KKX A;  1BN1 A;  1HCA A;  3OKU A;  3KON A;  3FE4 A;  2WEO A;  2ABE A;  1RZB A;  2Q38 A;  3EFI A;  1FSR A;  1CNW A;  1HUH A;  3JXH C;  1G53 A;  3DVD A;  2CBB A;  3DCW A;  1OKM A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  3M2Y A;  1CCS A;  1UGG A;  1TH9 A;  2OSM A;  1RAZ A;  2NWO A;  1I9L A;  1OQ5 A;  3MHC A;  1JD0 A;  5CA2 A;  1YO0 A;  3IAI A;  3K7K A;  1CIL A;  1CA3 A;  1BNU A;  3HKQ A;  3D9Z A;  3DCS A;  2FNN A;  1DCA A;  3LXE A;  2WEJ A;  1CVE A;  1RZE A;  2POW A;  3P4V A;  1CNH A;  3OIK A;  3ZNC A;  2OSF A;  1FQN A;  1V9I C;  2AW1 A;  1CAM A;  3N2P A;  1YDC A;  2FOU A;  1TE3 X;  1KWR A;  3HLJ A;  1UGB A;  1H4N A;  1HED A;  1IF9 A;  1FR7 A;  2EZ7 A;  1G4J A;  3OIL A;  1H9N A;  6CA2 A;  3JXG A;  3IBL A;  1G6V A;  1V9E A;  1HVA A;  3M1K A;  1G0F A;  3D93 A;  1DCB A;  3BL0 A;  2NNO A;  1I9Q A;  2GEH A;  2NNS A;  3DAZ A;  1G3Z A;  1TTM A;  2VVA X;  1ZNC A;  2WEG A;  1G48 A; 
2HFYA
similar chains in the KnotProt database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 2HFY A; 
               
               
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling