| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 12-261 | 250 | 1-11, 262-383 | 11 | 122 | knot |
Chain Sequence |
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
2.1 | 18-276 | 259 | 1-17 | 346-383 | 277-345 | 17 | 38 | slipknot | ||
| view details |
|
2.1 | 12-352 | 341 | 1-3, 365-383 | 4-11, 353-364 | 3 | 19 | slipknot | |||
| view details |
|
1.1 | 18-348 | 331 | 1-4, 363-383 | 5-17, 349-362 | 4 | 21 | slipknot | |||
| view details |
|
2.1 | 20-360 | 341 | 361-383 | 1-5 | 6-19 | 5 | 22 | slipknot |
| sequence length |
383
|
| structure length |
383
|
| publication title |
Crystal structure of the S-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
S-adenosylmethionine synthetase
|
| source organism |
Escherichia coli
|
| total genus |
Genus: 122
|
| ec nomenclature |
ec
2.5.1.6: Methionine adenosyltransferase. |
| pdb deposition date | 2003-11-11 |
| KnotProt deposition date | 2014-07-31 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | GMP Synthetase; Chain A, domain 3 | GMP Synthetase; Chain A, domain 3 | ||
| Alpha Beta | 2-Layer Sandwich | GMP Synthetase; Chain A, domain 3 | GMP Synthetase; Chain A, domain 3 | ||
| Alpha Beta | 2-Layer Sandwich | GMP Synthetase; Chain A, domain 3 | GMP Synthetase; Chain A, domain 3 |
#chains in the KnotProt database with same CATH superfamily 1FUG A; 3IML A; 2OBV A; 1O92 A; 1XRA A; 2P02 A; 1P7L A; 1O93 A; 1O9T A; 1MXC A; 1O90 A; 1XRB A; 1XRC A; 1MXB A; 1QM4 A; 1RG9 A; 1MXA A; #chains in the KnotProt database with same CATH topology 1FUG A; 3IML A; 2OBV A; 1O92 A; 1XRA A; 2P02 A; 1P7L A; 1O93 A; 1O9T A; 1MXC A; 1O90 A; 1XRB A; 1XRC A; 1MXB A; 1QM4 A; 1RG9 A; 1MXA A; #chains in the KnotProt database with same CATH homology 1FUG A; 3IML A; 2OBV A; 1O92 A; 1XRA A; 2P02 A; 1P7L A; 1O93 A; 1O9T A; 1MXC A; 1O90 A; 1XRB A; 1XRC A; 1MXB A; 1QM4 A; 1RG9 A; 1MXA A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...