1P7LA

S-adenosylmethionine synthetase complexed with amppnp and met.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 12-261 250 1-11, 262-383 11 122 knot
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 17-276 260 1-16 346-383 277-345 16 38 slipknot
view details
1.1 17-242 226 1-4, 253-383 5-16, 243-252 4 131 slipknot
view details
2.1 18-362 345 363-383 1-4 5-17 4 20 slipknot
view details
1.1 17-349 333 1-7, 363-383 8-16, 350-362 7 21 slipknot
sequence length 383
structure length 383
publication title Crystal structure of the s-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
pubmed doi rcsb
molecule tags Transferase
molecule keywords S-adenosylmethionine synthetase
source organism Escherichia coli
total genus Genus: 121
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2003-05-02
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1p7lA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1p7lA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1p7lA01
1XRAA 1MXBA 1QM4A 1O93A 1XRCA 1MXAA 1P7LA 3IMLA 1XRBA 1RG9A 1O9TA 1MXCA 1O92A 2P02A 1O90A 1FUGA 2OBVA
chains in the KnotProt database with same CATH superfamily
1XRAA 1MXBA 1QM4A 1O93A 1XRCA 1MXAA 1P7LA 3IMLA 1XRBA 1RG9A 1O9TA 1MXCA 1O92A 2P02A 1O90A 1FUGA 2OBVA
chains in the KnotProt database with same CATH topology
1XRAA 1MXBA 1QM4A 1O93A 1XRCA 1MXAA 1P7LA 3IMLA 1XRBA 1RG9A 1O9TA 1MXCA 1O92A 2P02A 1O90A 1FUGA 2OBVA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1XRA A;  1MXB A;  1QM4 A;  1O93 A;  1XRC A;  1MXA A;  1P7L A;  3IML A;  1XRB A;  1RG9 A;  1O9T A;  1MXC A;  1O92 A;  2P02 A;  1O90 A;  1FUG A;  2OBV A; 
#chains in the KnotProt database with same CATH topology
 1XRA A;  1MXB A;  1QM4 A;  1O93 A;  1XRC A;  1MXA A;  1P7L A;  3IML A;  1XRB A;  1RG9 A;  1O9T A;  1MXC A;  1O92 A;  2P02 A;  1O90 A;  1FUG A;  2OBV A; 
#chains in the KnotProt database with same CATH homology
 1XRA A;  1MXB A;  1QM4 A;  1O93 A;  1XRC A;  1MXA A;  1P7L A;  3IML A;  1XRB A;  1RG9 A;  1O9T A;  1MXC A;  1O92 A;  2P02 A;  1O90 A;  1FUG A;  2OBV A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling