1XRCA

Crystal structure of s-adenosylmethionine synthetase
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 17-265 249 1-16, 266-383 16 118 knot
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPD------RADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 7-238 232 1-6 247-377 239-246 6 131 slipknot
view details
2.1 20-266 247 1-4, 335-377 5-19, 267-334 4 43 slipknot
view details
2.1 20-356 337 357-377 1-4 5-19 4 20 slipknot
view details
1.1 14-252 239 1-5, 262-377 6-13, 253-261 5 116 slipknot
view details
1.1 18-340 323 1-6, 356-377 7-17, 341-355 6 22 slipknot
sequence length 383
structure length 377
publication title Crystal structure of S-adenosylmethionine synthetase.
pubmed doi rcsb
molecule tags Methyltransferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
missing residues 102-107
total genus Genus: 122
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1995-10-26
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrcA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrcA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrcA01
1XRAA 1MXBA 1QM4A 1O93A 1XRCA 1MXAA 1P7LA 3IMLA 1XRBA 1RG9A 1O9TA 1MXCA 1O92A 2P02A 1O90A 1FUGA 2OBVA
chains in the KnotProt database with same CATH superfamily
1XRAA 1MXBA 1QM4A 1O93A 1XRCA 1MXAA 1P7LA 3IMLA 1XRBA 1RG9A 1O9TA 1MXCA 1O92A 2P02A 1O90A 1FUGA 2OBVA
chains in the KnotProt database with same CATH topology
1XRAA 1MXBA 1QM4A 1O93A 1XRCA 1MXAA 1P7LA 3IMLA 1XRBA 1RG9A 1O9TA 1MXCA 1O92A 2P02A 1O90A 1FUGA 2OBVA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1XRA A;  1MXB A;  1QM4 A;  1O93 A;  1XRC A;  1MXA A;  1P7L A;  3IML A;  1XRB A;  1RG9 A;  1O9T A;  1MXC A;  1O92 A;  2P02 A;  1O90 A;  1FUG A;  2OBV A; 
#chains in the KnotProt database with same CATH topology
 1XRA A;  1MXB A;  1QM4 A;  1O93 A;  1XRC A;  1MXA A;  1P7L A;  3IML A;  1XRB A;  1RG9 A;  1O9T A;  1MXC A;  1O92 A;  2P02 A;  1O90 A;  1FUG A;  2OBV A; 
#chains in the KnotProt database with same CATH homology
 1XRA A;  1MXB A;  1QM4 A;  1O93 A;  1XRC A;  1MXA A;  1P7L A;  3IML A;  1XRB A;  1RG9 A;  1O9T A;  1MXC A;  1O92 A;  2P02 A;  1O90 A;  1FUG A;  2OBV A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling