| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 21-113 | 93 | 1-20 | 123-131 | 114-122 | 20 | 9 | slipknot |
Chain Sequence |
MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSEQEIEYLSHEEFKLLTKDAKAVIRTGEFTPYANCILQAGVLF
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 7-112 | 106 | 1-6 | 117-131 | 113-116 | 6 | 15 | slipknot | ||
| view details |
 |
3.1 | 12-113 | 102 | 1-11 | 120-131 | 114-119 | 11 | 12 | slipknot | ||
| view details |
|
2.1 | 12-119 | 108 | 1-11 | 123-131 | 120-122 | 11 | 9 | slipknot | ||
| view details |
|
2.1 | 11-122 | 112 | 1-3, 125-131 | 4-10, 123-124 | 3 | 7 | slipknot | |||
| view details |
|
2.1 | 17-112 | 96 | 1-9, 117-131 | 10-16, 113-116 | 9 | 15 | slipknot | |||
| view details |
|
3.1 | 25-113 | 89 | 1-11, 122-131 | 12-24, 114-121 | 11 | 10 | slipknot | |||
| view details |
|
2.1 | 25-121 | 97 | 1-11, 123-131 | 12-24, 122-122 | 11 | 9 | slipknot |
| sequence length |
131
|
| structure length |
131
|
| publication title |
Crystal Structures of Rbsd Leading to the Identification of Cytoplasmic Sugar-Binding Proteins with a Novel Folding Architecture
pubmed doi rcsb |
| molecule tags |
Transport
|
| molecule keywords |
HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
|
| total genus |
 Genus: 37
|
| ec nomenclature |
ec
5.4.99.62: D-ribose pyranase. |
| pdb deposition date | 2003-04-30 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05025 | RbsD_FucU | RbsD / FucU transport protein family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | RbsD-like fold | RbsD-like domain |
#chains in the KnotProt database with same CATH superfamily 3E7N A; 2WCU A; 1OGF A; 2WCV A; 3MVK A; 2OB5 A; 4A34 A; 3P12 A; 1OGC A; 1OGD A; 1OGE A; 3P13 A; #chains in the KnotProt database with same CATH topology 3E7N A; 2WCU A; 1OGF A; 2WCV A; 3MVK A; 2OB5 A; 4A34 A; 3P12 A; 1OGC A; 1OGD A; 1OGE A; 3P13 A; #chains in the KnotProt database with same CATH homology 3E7N A; 2WCU A; 1OGF A; 2WCV A; 3MVK A; 2OB5 A; 4A34 A; 3P12 A; 1OGC A; 1OGD A; 1OGE A; 3P13 A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
