2OB5A

Crystal structure of protein atu2016, putative sugar binding protein
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 30-132 103 1-29 144-151 133-143 29 8 slipknot
Chain Sequence
YFQGMLKNIDPALNADVLHALRAMGHGDTLVISDTNFPSDSVARQTTVGKVLHIDNVSAARAMKAILSVLPLDTPLQPSVGRMEVMGAPDQLEPVQVEVQQEIDAAEGKSAPMYGIERFAFYEKAKQAYCVITTGETRFYGCFLLTKGVIP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 16-130 115 1-15 136-151 131-135 15 16 slipknot
view details
3.1 30-134 105 1-29 142-151 135-141 29 10 slipknot
view details
2.1 21-141 121 1-20 146-151 142-145 20 6 slipknot
publication title Crystal structure of protein Atu2016, putative sugar binding protein
rcsb
structure length 151
molecule tags Sugar binding protein
source organism Agrobacterium tumefaciens str.
sequence length 151
total genus Genus: 36
molecule keywords Hypothetical protein Atu2016
ec nomenclature
pdb deposition date 2006-12-18
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 2ob5A00
1OGFA 2WCVA 3P13A 1OGCA 3E7NA 2WCUA 3P12A 1OGDA 4A34A 2OB5A 1OGEA 3MVKA
chains in the KnotProt database with same CATH superfamily
1OGFA 2WCVA 3P13A 1OGCA 3E7NA 2WCUA 3P12A 1OGDA 4A34A 2OB5A 1OGEA 3MVKA
chains in the KnotProt database with same CATH topology
1OGFA 2WCVA 3P13A 1OGCA 3E7NA 2WCUA 3P12A 1OGDA 4A34A 2OB5A 1OGEA 3MVKA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1OGF A;  2WCV A;  3P13 A;  1OGC A;  3E7N A;  2WCU A;  3P12 A;  1OGD A;  4A34 A;  2OB5 A;  1OGE A;  3MVK A; 
#chains in the KnotProt database with same CATH topology
 1OGF A;  2WCV A;  3P13 A;  1OGC A;  3E7N A;  2WCU A;  3P12 A;  1OGD A;  4A34 A;  2OB5 A;  1OGE A;  3MVK A; 
#chains in the KnotProt database with same CATH homology
 1OGF A;  2WCV A;  3P13 A;  1OGC A;  3E7N A;  2WCU A;  3P12 A;  1OGD A;  4A34 A;  2OB5 A;  1OGE A;  3MVK A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling