| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 25-112 | 88 | 1-24 | 123-131 | 113-122 | 24 | 9 | slipknot |
Chain Sequence |
MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSEQEIEYLSHEEFKLLTKDAKAVIRTGEFTPYANCILQAGVLF
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
2.1 | 12-111 | 100 | 1-11 | 116-131 | 112-115 | 11 | 16 | slipknot | ||
| view details |
|
2.1 | 25-113 | 89 | 1-24 | 120-131 | 114-119 | 24 | 12 | slipknot | ||
| view details |
|
3.1 | 25-119 | 95 | 1-24 | 123-131 | 120-122 | 24 | 9 | slipknot | ||
| view details |
|
2.1 | 7-122 | 116 | 1-6 | 125-131 | 123-124 | 6 | 7 | slipknot |
| sequence length |
131
|
| structure length |
131
|
| publication title |
Crystal Structures of Rbsd Leading to the Identification of Cytoplasmic Sugar-Binding Proteins with a Novel Folding Architecture
pubmed doi rcsb |
| molecule tags |
Transport
|
| molecule keywords |
HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
|
| total genus |
Genus: 35
|
| ec nomenclature |
ec
5.4.99.62: D-ribose pyranase. |
| pdb deposition date | 2003-04-30 |
| KnotProt deposition date | 2014-08-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05025 | RbsD_FucU | RbsD / FucU transport protein family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | RbsD-like fold | RbsD-like domain |
#chains in the KnotProt database with same CATH superfamily 1OGF A; 2WCU A; 1OGD A; 2WCV A; 2OB5 A; 3P12 A; 1OGC A; 1OGE A; 4A34 A; 3E7N A; 3P13 A; 3MVK A; #chains in the KnotProt database with same CATH topology 1OGF A; 2WCU A; 1OGD A; 2WCV A; 2OB5 A; 3P12 A; 1OGC A; 1OGE A; 4A34 A; 3E7N A; 3P13 A; 3MVK A; #chains in the KnotProt database with same CATH homology 1OGF A; 2WCU A; 1OGD A; 2WCV A; 2OB5 A; 3P12 A; 1OGC A; 1OGE A; 4A34 A; 3E7N A; 3P13 A; 3MVK A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...