1OGEA

The structure of bacillus subtilis rbsd complexed with ribose 5-phosphate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-112 88 1-24 123-131 113-122 24 9 slipknot
Chain Sequence
MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSEQEIEYLSHEEFKLLTKDAKAVIRTGEFTPYANCILQAGVLF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 12-111 100 1-11 116-131 112-115 11 16 slipknot
view details
2.1 25-113 89 1-24 120-131 114-119 24 12 slipknot
view details
3.1 25-119 95 1-24 123-131 120-122 24 9 slipknot
view details
2.1 7-122 116 1-6 125-131 123-124 6 7 slipknot
sequence length 131
structure length 131
publication title Crystal Structures of Rbsd Leading to the Identification of Cytoplasmic Sugar-Binding Proteins with a Novel Folding Architecture
pubmed doi rcsb
molecule tags Transport
molecule keywords HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
total genus Genus: 35
ec nomenclature ec 5.4.99.62: D-ribose pyranase.
pdb deposition date 2003-04-30
KnotProt deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 1ogeA01
3P12A 4A34A 2OB5A 3E7NA 2WCUA 1OGDA 3MVKA 2WCVA 3P13A 1OGFA 1OGEA 1OGCA
chains in the KnotProt database with same CATH superfamily
3P12A 4A34A 2OB5A 3E7NA 2WCUA 1OGDA 3MVKA 2WCVA 3P13A 1OGFA 1OGEA 1OGCA
chains in the KnotProt database with same CATH topology
3P12A 4A34A 2OB5A 3E7NA 2WCUA 1OGDA 3MVKA 2WCVA 3P13A 1OGFA 1OGEA 1OGCA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3P12 A;  4A34 A;  2OB5 A;  3E7N A;  2WCU A;  1OGD A;  3MVK A;  2WCV A;  3P13 A;  1OGF A;  1OGE A;  1OGC A; 
#chains in the KnotProt database with same CATH topology
 3P12 A;  4A34 A;  2OB5 A;  3E7N A;  2WCU A;  1OGD A;  3MVK A;  2WCV A;  3P13 A;  1OGF A;  1OGE A;  1OGC A; 
#chains in the KnotProt database with same CATH homology
 3P12 A;  4A34 A;  2OB5 A;  3E7N A;  2WCU A;  1OGD A;  3MVK A;  2WCV A;  3P13 A;  1OGF A;  1OGE A;  1OGC A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling