3MVKA

The crystal structure of fucu from bifidobacterium longum to 1.65a
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 22-122 101 1-21 134-140 123-133 21 7 slipknot
Chain Sequence
IPKIIPPELLKVLCEMGHGDQLVIADGNFPAESIGKNAIVVRMDGHGGGEILKAILTVFPLDTYVDKPATLMEKVPGDTVATPIWDVYAGLIKEHDERGADAIGSLERFAFYEQAKNAYCVIASGESAQYANLILQKGVV
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 21-124 104 1-20 132-140 125-131 20 9 slipknot
view details
3.1 9-131 123 1-8 136-140 132-135 8 5 slipknot
view details
2.1 16-131 116 1-8, 136-140 9-15, 132-135 8 5 slipknot
view details
2.1 19-122 104 1-10, 125-140 11-18, 123-124 10 16 slipknot
view details
2.1 20-122 103 1-18, 125-140 19-19, 123-124 18 16 slipknot
publication title The Crystal Structure of FucU from Bifidobacterium longum to 1.65A
rcsb
structure length 140
molecule tags Isomerase
source organism Bifidobacterium longum subsp. infantis
sequence length 140
total genus Genus: 41
molecule keywords protein FucU
ec nomenclature
pdb deposition date 2010-05-04
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 3mvkA01
1OGFA 2WCVA 3P13A 1OGCA 3E7NA 2WCUA 3P12A 1OGDA 4A34A 2OB5A 1OGEA 3MVKA
chains in the KnotProt database with same CATH superfamily
1OGFA 2WCVA 3P13A 1OGCA 3E7NA 2WCUA 3P12A 1OGDA 4A34A 2OB5A 1OGEA 3MVKA
chains in the KnotProt database with same CATH topology
1OGFA 2WCVA 3P13A 1OGCA 3E7NA 2WCUA 3P12A 1OGDA 4A34A 2OB5A 1OGEA 3MVKA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1OGF A;  2WCV A;  3P13 A;  1OGC A;  3E7N A;  2WCU A;  3P12 A;  1OGD A;  4A34 A;  2OB5 A;  1OGE A;  3MVK A; 
#chains in the KnotProt database with same CATH topology
 1OGF A;  2WCV A;  3P13 A;  1OGC A;  3E7N A;  2WCU A;  3P12 A;  1OGD A;  4A34 A;  2OB5 A;  1OGE A;  3MVK A; 
#chains in the KnotProt database with same CATH homology
 1OGF A;  2WCV A;  3P13 A;  1OGC A;  3E7N A;  2WCU A;  3P12 A;  1OGD A;  4A34 A;  2OB5 A;  1OGE A;  3MVK A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling