3MVKA

The crystal structure of fucu from bifidobacterium longum to 1.65a
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 22-122 101 1-21 134-140 123-133 21 7 slipknot
Chain Sequence
IPKIIPPELLKVLCEMGHGDQLVIADGNFPAESIGKNAIVVRMDGHGGGEILKAILTVFPLDTYVDKPATLMEKVPGDTVATPIWDVYAGLIKEHDERGADAIGSLERFAFYEQAKNAYCVIASGESAQYANLILQKGVV
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 21-124 104 1-20 132-140 125-131 20 9 slipknot
view details
3.1 9-131 123 1-8 136-140 132-135 8 5 slipknot
view details
2.1 16-131 116 1-8, 136-140 9-15, 132-135 8 5 slipknot
view details
2.1 19-122 104 1-10, 125-140 11-18, 123-124 10 16 slipknot
view details
2.1 20-122 103 1-18, 125-140 19-19, 123-124 18 16 slipknot
sequence length 140
structure length 140
publication title The Crystal Structure of FucU from Bifidobacterium longum to 1.65A
rcsb
molecule tags Isomerase
molecule keywords protein FucU
source organism Bifidobacterium longum subsp. infantis
total genus Genus: 41
ec nomenclature
pdb deposition date 2010-05-04
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 3mvkA01
4A34A 3P13A 1OGFA 2OB5A 1OGDA 2WCVA 2WCUA 1OGEA 3P12A 1OGCA 3MVKA 3E7NA
chains in the KnotProt database with same CATH superfamily
4A34A 3P13A 1OGFA 2OB5A 1OGDA 2WCVA 2WCUA 1OGEA 3P12A 1OGCA 3MVKA 3E7NA
chains in the KnotProt database with same CATH topology
4A34A 3P13A 1OGFA 2OB5A 1OGDA 2WCVA 2WCUA 1OGEA 3P12A 1OGCA 3MVKA 3E7NA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 4A34 A;  3P13 A;  1OGF A;  2OB5 A;  1OGD A;  2WCV A;  2WCU A;  1OGE A;  3P12 A;  1OGC A;  3MVK A;  3E7N A; 
#chains in the KnotProt database with same CATH topology
 4A34 A;  3P13 A;  1OGF A;  2OB5 A;  1OGD A;  2WCV A;  2WCU A;  1OGE A;  3P12 A;  1OGC A;  3MVK A;  3E7N A; 
#chains in the KnotProt database with same CATH homology
 4A34 A;  3P13 A;  1OGF A;  2OB5 A;  1OGD A;  2WCV A;  2WCU A;  1OGE A;  3P12 A;  1OGC A;  3MVK A;  3E7N A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling