2WCUA

Crystal structure of mammalian fucu
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 28-130 103 1-27 142-149 131-141 27 8 slipknot
Chain Sequence
MVALKGIPKVLSPELLFALARMGHGDEIVLADANFPTSSICQCGPVEIRADGLDIPQLLEAVLRLLPLDTYVESPAAVMDLVPSDKEKGLQTPIWKRYESLLLEADCKKTLMKLERFEFYERAKKAFAVVATGEMALYGNIILKKGTLD
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 9-130 122 1-8 138-149 131-137 8 12 slipknot
view details
3.1 15-131 117 1-9, 138-149 10-14, 132-137 9 12 slipknot
view details
3.1 15-137 123 1-9, 141-149 10-14, 138-140 9 9 slipknot
view details
3.1 22-132 111 1-14, 140-149 15-21, 133-139 14 10 slipknot
view details
3.1 25-132 108 1-21, 140-149 22-24, 133-139 21 10 slipknot
view details
3.1 27-133 107 1-24, 140-149 25-26, 134-139 24 10 slipknot
sequence length 149
structure length 149
publication title Crystal Structures and Enzyme Mechanism of a Dual Fucose Mutarotase/Ribose Pyranase
pubmed doi rcsb
molecule tags Isomerase
molecule keywords PROTEIN FUCU HOMOLOG
source organism Mus musculus
total genus Genus: 44
ec nomenclature ec 5.1.3.29: L-fucose mutarotase.
pdb deposition date 2009-03-17
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 2wcuA01
2WCUA 3P12A 2OB5A 3P13A 3MVKA 1OGEA 1OGDA 1OGFA 3E7NA 1OGCA 4A34A 2WCVA
chains in the KnotProt database with same CATH superfamily
2WCUA 3P12A 2OB5A 3P13A 3MVKA 1OGEA 1OGDA 1OGFA 3E7NA 1OGCA 4A34A 2WCVA
chains in the KnotProt database with same CATH topology
2WCUA 3P12A 2OB5A 3P13A 3MVKA 1OGEA 1OGDA 1OGFA 3E7NA 1OGCA 4A34A 2WCVA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2WCU A;  3P12 A;  2OB5 A;  3P13 A;  3MVK A;  1OGE A;  1OGD A;  1OGF A;  3E7N A;  1OGC A;  4A34 A;  2WCV A; 
#chains in the KnotProt database with same CATH topology
 2WCU A;  3P12 A;  2OB5 A;  3P13 A;  3MVK A;  1OGE A;  1OGD A;  1OGF A;  3E7N A;  1OGC A;  4A34 A;  2WCV A; 
#chains in the KnotProt database with same CATH homology
 2WCU A;  3P12 A;  2OB5 A;  3P13 A;  3MVK A;  1OGE A;  1OGD A;  1OGF A;  3E7N A;  1OGC A;  4A34 A;  2WCV A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling