1OGFA

The structure of bacillus subtilis rbsd complexed with glycerol
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-113 89 1-24 123-131 114-122 24 9 slipknot
Chain Sequence
MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSEQEIEYLSHEEFKLLTKDAKAVIRTGEFTPYANCILQAGVLF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 15-115 101 1-14 125-131 116-124 14 7 slipknot
view details
3.1 6-124 119 1-5 126-131 125-125 5 6 slipknot
view details
2.1 11-124 114 1-5, 126-131 6-10, 125-125 5 6 slipknot
view details
3.1 25-114 90 1-15, 122-131 16-24, 115-121 15 10 slipknot
sequence length 131
structure length 131
publication title Crystal Structures of Rbsd Leading to the Identification of Cytoplasmic Sugar-Binding Proteins with a Novel Folding Architecture
pubmed doi rcsb
molecule tags Transport
molecule keywords HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
total genus Genus: 37
ec nomenclature ec 5.4.99.62: D-ribose pyranase.
pdb deposition date 2003-04-30
KnotProt deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 1ogfA01
4A34A 3P13A 1OGFA 2OB5A 1OGDA 2WCVA 2WCUA 1OGEA 3P12A 1OGCA 3MVKA 3E7NA
chains in the KnotProt database with same CATH superfamily
4A34A 3P13A 1OGFA 2OB5A 1OGDA 2WCVA 2WCUA 1OGEA 3P12A 1OGCA 3MVKA 3E7NA
chains in the KnotProt database with same CATH topology
4A34A 3P13A 1OGFA 2OB5A 1OGDA 2WCVA 2WCUA 1OGEA 3P12A 1OGCA 3MVKA 3E7NA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 4A34 A;  3P13 A;  1OGF A;  2OB5 A;  1OGD A;  2WCV A;  2WCU A;  1OGE A;  3P12 A;  1OGC A;  3MVK A;  3E7N A; 
#chains in the KnotProt database with same CATH topology
 4A34 A;  3P13 A;  1OGF A;  2OB5 A;  1OGD A;  2WCV A;  2WCU A;  1OGE A;  3P12 A;  1OGC A;  3MVK A;  3E7N A; 
#chains in the KnotProt database with same CATH homology
 4A34 A;  3P13 A;  1OGF A;  2OB5 A;  1OGD A;  2WCV A;  2WCU A;  1OGE A;  3P12 A;  1OGC A;  3MVK A;  3E7N A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling