| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 30-132 | 103 | 1-29 | 144-151 | 133-143 | 29 | 8 | slipknot |
Chain Sequence |
YFQGMLKNIDPALNADVLHALRAMGHGDTLVISDTNFPSDSVARQTTVGKVLHIDNVSAARAMKAILSVLPLDTPLQPSVGRMEVMGAPDQLEPVQVEVQQEIDAAEGKSAPMYGIERFAFYEKAKQAYCVITTGETRFYGCFLLTKGVIP
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 16-130 | 115 | 1-15 | 136-151 | 131-135 | 15 | 16 | slipknot | ||
| view details |
 |
3.1 | 30-134 | 105 | 1-29 | 142-151 | 135-141 | 29 | 10 | slipknot | ||
| view details |
|
2.1 | 21-141 | 121 | 1-20 | 146-151 | 142-145 | 20 | 6 | slipknot |
| sequence length |
151
|
| structure length |
151
|
| publication title |
Crystal structure of protein Atu2016, putative sugar binding protein
rcsb |
| molecule tags |
Sugar binding protein
|
| molecule keywords |
Hypothetical protein Atu2016
|
| source organism |
Agrobacterium tumefaciens str.
|
| total genus |
 Genus: 36
|
| ec nomenclature | |
| pdb deposition date | 2006-12-18 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05025 | RbsD_FucU | RbsD / FucU transport protein family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | RbsD-like fold | RbsD-like domain |
#chains in the KnotProt database with same CATH superfamily 3E7N A; 2WCU A; 1OGF A; 2WCV A; 3MVK A; 2OB5 A; 4A34 A; 3P12 A; 1OGC A; 1OGD A; 1OGE A; 3P13 A; #chains in the KnotProt database with same CATH topology 3E7N A; 2WCU A; 1OGF A; 2WCV A; 3MVK A; 2OB5 A; 4A34 A; 3P12 A; 1OGC A; 1OGD A; 1OGE A; 3P13 A; #chains in the KnotProt database with same CATH homology 3E7N A; 2WCU A; 1OGF A; 2WCV A; 3MVK A; 2OB5 A; 4A34 A; 3P12 A; 1OGC A; 1OGD A; 1OGE A; 3P13 A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
