
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 28-130 | 103 | 1-27 | 142-149 | 131-141 | 27 | 8 | slipknot |
Chain Sequence |
MVALKGIPKVLSPELLFALARMGHGDEIVLADANFPTSSICQCGPVEIRADGLDIPQLLEAVLRLLPLDTYVESPAAVMDLVPSDKEKGLQTPIWKRYESLLLEADCKKTLMKLERFEFYERAKKAFAVVATGEMALYGNIILKKGTLD
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 9-130 | 122 | 1-8 | 138-149 | 131-137 | 8 | 12 | slipknot | ||
view details |
![]() |
3.1 | 15-131 | 117 | 1-9, 138-149 | 10-14, 132-137 | 9 | 12 | slipknot | |||
view details |
![]() |
3.1 | 15-137 | 123 | 1-9, 141-149 | 10-14, 138-140 | 9 | 9 | slipknot | |||
view details |
![]() |
3.1 | 22-132 | 111 | 1-14, 140-149 | 15-21, 133-139 | 14 | 10 | slipknot | |||
view details |
![]() |
3.1 | 25-132 | 108 | 1-21, 140-149 | 22-24, 133-139 | 21 | 10 | slipknot | |||
view details |
![]() |
3.1 | 27-133 | 107 | 1-24, 140-149 | 25-26, 134-139 | 24 | 10 | slipknot |
sequence length |
149
|
structure length |
149
|
publication title |
Crystal Structures and Enzyme Mechanism of a Dual Fucose Mutarotase/Ribose Pyranase
pubmed doi rcsb |
molecule tags |
Isomerase
|
molecule keywords |
PROTEIN FUCU HOMOLOG
|
source organism |
Mus musculus
|
total genus |
![]() |
ec nomenclature |
ec
5.1.3.29: L-fucose mutarotase. |
pdb deposition date | 2009-03-17 |
KnotProt deposition date | 2014-07-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05025 | RbsD_FucU | RbsD / FucU transport protein family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | RbsD-like fold | RbsD-like domain |
#chains in the KnotProt database with same CATH superfamily 1OGD A; 2WCU A; 2WCV A; 3P12 A; 1OGE A; 3P13 A; 1OGF A; 3MVK A; 2OB5 A; 1OGC A; 4A34 A; 3E7N A; #chains in the KnotProt database with same CATH topology 1OGD A; 2WCU A; 2WCV A; 3P12 A; 1OGE A; 3P13 A; 1OGF A; 3MVK A; 2OB5 A; 1OGC A; 4A34 A; 3E7N A; #chains in the KnotProt database with same CATH homology 1OGD A; 2WCU A; 2WCV A; 3P12 A; 1OGE A; 3P13 A; 1OGF A; 3MVK A; 2OB5 A; 1OGC A; 4A34 A; 3E7N A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...