2WCUA

Crystal structure of mammalian fucu
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 28-130 103 1-27 142-149 131-141 27 8 slipknot
Chain Sequence
MVALKGIPKVLSPELLFALARMGHGDEIVLADANFPTSSICQCGPVEIRADGLDIPQLLEAVLRLLPLDTYVESPAAVMDLVPSDKEKGLQTPIWKRYESLLLEADCKKTLMKLERFEFYERAKKAFAVVATGEMALYGNIILKKGTLD
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 9-130 122 1-8 138-149 131-137 8 12 slipknot
view details
3.1 15-131 117 1-9, 138-149 10-14, 132-137 9 12 slipknot
view details
3.1 15-137 123 1-9, 141-149 10-14, 138-140 9 9 slipknot
view details
3.1 22-132 111 1-14, 140-149 15-21, 133-139 14 10 slipknot
view details
3.1 25-132 108 1-21, 140-149 22-24, 133-139 21 10 slipknot
view details
3.1 27-133 107 1-24, 140-149 25-26, 134-139 24 10 slipknot
publication title Crystal Structures and Enzyme Mechanism of a Dual Fucose Mutarotase/Ribose Pyranase
pubmed doi rcsb
structure length 149
molecule tags Isomerase
source organism Mus musculus
sequence length 149
total genus Genus: 44
molecule keywords PROTEIN FUCU HOMOLOG
ec nomenclature ec 5.1.3.29: L-fucose mutarotase.
pdb deposition date 2009-03-17
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 2wcuA01
1OGFA 2WCVA 3P13A 1OGCA 3E7NA 2WCUA 3P12A 1OGDA 4A34A 2OB5A 1OGEA 3MVKA
chains in the KnotProt database with same CATH superfamily
1OGFA 2WCVA 3P13A 1OGCA 3E7NA 2WCUA 3P12A 1OGDA 4A34A 2OB5A 1OGEA 3MVKA
chains in the KnotProt database with same CATH topology
1OGFA 2WCVA 3P13A 1OGCA 3E7NA 2WCUA 3P12A 1OGDA 4A34A 2OB5A 1OGEA 3MVKA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1OGF A;  2WCV A;  3P13 A;  1OGC A;  3E7N A;  2WCU A;  3P12 A;  1OGD A;  4A34 A;  2OB5 A;  1OGE A;  3MVK A; 
#chains in the KnotProt database with same CATH topology
 1OGF A;  2WCV A;  3P13 A;  1OGC A;  3E7N A;  2WCU A;  3P12 A;  1OGD A;  4A34 A;  2OB5 A;  1OGE A;  3MVK A; 
#chains in the KnotProt database with same CATH homology
 1OGF A;  2WCV A;  3P13 A;  1OGC A;  3E7N A;  2WCU A;  3P12 A;  1OGD A;  4A34 A;  2OB5 A;  1OGE A;  3MVK A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling