3FSGA

Crystal structure of alpha/beta superfamily hydrolase from oenococcus oeni psu-1
Slipknot S +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 82-216 135 1-1, 245-267 2-81, 217-244 1 23 slipknot
Chain Sequence
MKEYLTRSNISYFSIGSGTPIIFLHGLSLDKQSTCLFFEPLSNVGQYQRIYLDLPGMGNSDPISPSTSDNVLETLIEAIEEIIGARRFILYGHSYGGYLAQAIAFHLKDQTLGVFLTCPVITADHSKRLTGKHINILEEDINPVENKEYFADFLSMNVIINNQAWHDYQNLIIPGLQKEDKTFIDQLQNNYSFTFEEKLKNINYQFPFKIMVGRNDQVVGYQEQLKLINHNENGEIVLLNRTGHNLMIDQREAVGFHFDLFLDELNS
sequence length 267
structure length 267
publication title Crystal structure of alpha/beta superfamily hydrolase from Oenococcus oeni PSU-1
rcsb
molecule tags Hydrolase
molecule keywords Alpha/beta superfamily hydrolase
source organism Oenococcus oeni
ec nomenclature
pdb deposition date2009-01-09
KnotProt deposition date2014-07-31

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
A PF12697 Abhydrolase_6Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fsgA00
3FSGA 1LNSA
chains in the KnotProt database with same CATH superfamily
3RDPA 3M4NA 3FSGA 3L04A 1E2NA 1KI6A 4IVPA 3KZKA 1QMGA 3KZCA 3L02A 2FG7C 1VTKA 4JBXA 3FR8A 2FG6C 2G7MC 1KI6B 3F0TA 1LNSA 1E2HA 1KI4A 1JS1X 3KZMA 3M5DA 3FR7A 1QHIA 1YRLA 1OF1A 3M5CA 3L05A 4IVRA 1E2IA 1KI3A 1P75A 2VTKA 1YH1A 1F48A 1YVEI 1E2LA 1KI8A 3M4JA 2XTJA 1E2PA 4JBYA 2FG7X 1E2JA 1KI2A 1P72A 1E2KA 3KZOA 1P7CA 2KI5A 3L06A 1E2MA 1KI7A 4IVQA 1KIMA 1P6XA 3VTKA 1OSNA 1P73A 3KZNA
chains in the KnotProt database with same CATH topology
3M4NA 3FSGA 3KZKA 3L02A 2FG7C 2FG6C 1LNSA 3M5CA 1JS1X 3KZMA 3M5DA 3KZCA 3L05A 3L04A 2XTJA 1YH1A 3KZNA 3M4JA 2FG7X 2G7MC 3KZOA 3L06A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3FSG A;  1LNS A; 
#chains in the KnotProt database with same CATH topology
 3RDP A;  3M4N A;  3FSG A;  3L04 A;  1E2N A;  1KI6 A;  4IVP A;  3KZK A;  1QMG A;  3KZC A;  3L02 A;  2FG7 C;  1VTK A;  4JBX A;  3FR8 A;  2FG6 C;  2G7M C;  1KI6 B;  3F0T A;  1LNS A;  1E2H A;  1KI4 A;  1JS1 X;  3KZM A;  3M5D A;  3FR7 A;  1QHI A;  1YRL A;  1OF1 A;  3M5C A;  3L05 A;  4IVR A;  1E2I A;  1KI3 A;  1P75 A;  2VTK A;  1YH1 A;  1F48 A;  1YVE I;  1E2L A;  1KI8 A;  3M4J A;  2XTJ A;  1E2P A;  4JBY A;  2FG7 X;  1E2J A;  1KI2 A;  1P72 A;  1E2K A;  3KZO A;  1P7C A;  2KI5 A;  3L06 A;  1E2M A;  1KI7 A;  4IVQ A;  1KIM A;  1P6X A;  3VTK A;  1OSN A;  1P73 A;  3KZN A; 
#chains in the KnotProt database with same CATH homology
 3M4N A;  3FSG A;  3KZK A;  3L02 A;  2FG7 C;  2FG6 C;  1LNS A;  3M5C A;  1JS1 X;  3KZM A;  3M5D A;  3KZC A;  3L05 A;  3L04 A;  2XTJ A;  1YH1 A;  3KZN A;  3M4J A;  2FG7 X;  2G7M C;  3KZO A;  3L06 A; 
3FSGA 3FSGD
similar chains in the KnotProt database (40% sequence similarity)
3FSGB 3FSGC
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 3FSG A; 
               
               
#similar chains, but unknotted
 3FSG D;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3FSG B;  3FSG C; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling