1MDAM

Crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 29-87 59 1-28, 88-95 28 8 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureVal7 <-> Ala127
... Trp107 <-> Trq57 ... Cys29 <-> Cys61 ... Cys88 <-> Cys23 ... Val7
probabilistic
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIAGNICDCSAGSLTSCPPGTLVASGS-VGSCYNPPDPNKYITAYRDCCGYNVSGRCACLNTEGELPVYNKDANDIIWCFGGEDGMTYHCSISPVSGA
sequence length 121
structure length 120
publication title Crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
source organism Paracoccus denitrificans
missing residues 51
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 1992-03-02
KnotProt deposition date 2018-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 1mdaM00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 1mdaM00
1MDAM 2HXCD 2HKRD 2AGXD 2IUQD 2Q7QD 2IAAB 2OK4D 2AH0D 2IUVD 2J57K 2OIZD 1MG3B 2MADL 2J55L 2GC4B 2MTAL 2IUPD 2AGYD 2IURD 2HKMD 2I0TD 2HJBD 2H47B 2I0SD 2AGLD 2HJ4D 2AH1D 2J56L 2OJYD 2AGWD 2BBKL 2H3XB 3L4OC 1MG2B 3C75L 2GC7B
chains in the KnotProt database with same CATH superfamily
1MDAM 2HXCD 2HKRD 2AGXD 2IUQD 2Q7QD 2IAAB 2OK4D 2AH0D 2IUVD 2J57K 2OIZD 1MG3B 2MADL 2J55L 2GC4B 2MTAL 2IUPD 2AGYD 2IURD 2HKMD 2I0TD 2HJBD 2H47B 2I0SD 2AGLD 2HJ4D 2AH1D 2J56L 2OJYD 2AGWD 2BBKL 2H3XB 3L4OC 1MG2B 3C75L 2GC7B
chains in the KnotProt database with same CATH topology
1MDAM 2HXCD 2HKRD 2AGXD 2IUQD 2Q7QD 2IAAB 2OK4D 2AH0D 2IUVD 2J57K 2OIZD 1MG3B 2MADL 2J55L 2GC4B 2MTAL 2IUPD 2AGYD 2IURD 2HKMD 2I0TD 2HJBD 2H47B 2I0SD 2AGLD 2HJ4D 2AH1D 2J56L 2OJYD 2AGWD 2BBKL 2H3XB 3L4OC 1MG2B 3C75L 2GC7B
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1MDA M;  2HXC D;  2HKR D;  2AGX D;  2IUQ D;  2Q7Q D;  2IAA B;  2OK4 D;  2AH0 D;  2IUV D;  2J57 K;  2OIZ D;  1MG3 B;  2MAD L;  2J55 L;  2GC4 B;  2MTA L;  2IUP D;  2AGY D;  2IUR D;  2HKM D;  2I0T D;  2HJB D;  2H47 B;  2I0S D;  2AGL D;  2HJ4 D;  2AH1 D;  2J56 L;  2OJY D;  2AGW D;  2BBK L;  2H3X B;  3L4O C;  1MG2 B;  3C75 L;  2GC7 B; 
#chains in the KnotProt database with same CATH topology
 1MDA M;  2HXC D;  2HKR D;  2AGX D;  2IUQ D;  2Q7Q D;  2IAA B;  2OK4 D;  2AH0 D;  2IUV D;  2J57 K;  2OIZ D;  1MG3 B;  2MAD L;  2J55 L;  2GC4 B;  2MTA L;  2IUP D;  2AGY D;  2IUR D;  2HKM D;  2I0T D;  2HJB D;  2H47 B;  2I0S D;  2AGL D;  2HJ4 D;  2AH1 D;  2J56 L;  2OJY D;  2AGW D;  2BBK L;  2H3X B;  3L4O C;  1MG2 B;  3C75 L;  2GC7 B; 
#chains in the KnotProt database with same CATH homology
 1MDA M;  2HXC D;  2HKR D;  2AGX D;  2IUQ D;  2Q7Q D;  2IAA B;  2OK4 D;  2AH0 D;  2IUV D;  2J57 K;  2OIZ D;  1MG3 B;  2MAD L;  2J55 L;  2GC4 B;  2MTA L;  2IUP D;  2AGY D;  2IUR D;  2HKM D;  2I0T D;  2HJB D;  2H47 B;  2I0S D;  2AGL D;  2HJ4 D;  2AH1 D;  2J56 L;  2OJY D;  2AGW D;  2BBK L;  2H3X B;  3L4O C;  1MG2 B;  3C75 L;  2GC7 B; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling