2MADL

The active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 29-88 60 1-28, 89-97 28 9 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureVal7 <-> Ala130
... Trp108 <-> Trq57 ... Cys29 <-> Cys61 ... Cys88 <-> Cys23 ... Val7
probabilistic
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATAS-VASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
sequence length 124
structure length 123
publication title Active site structure of methylamine dehydrogenase: hydrazines identify C6 as the reactive site of the tryptophan-derived quinone cofactor.
pubmed doi rcsb
molecule tags Oxidoreductase(chnh2(d)-deaminating)
molecule keywords METHYLAMINE DEHYDROGENASE (LIGHT SUBUNIT)
source organism Paracoccus versutus
missing residues 51
total genus Genus: 29
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1992-05-20
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2madL00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2madL00
2J57K 2Q7QD 2MTAL 2GC7B 2HJBD 2HJ4D 2OK4D 2IURD 1MG3B 2H3XB 2I0TD 2AGLD 2AGWD 2J55L 2OJYD 2I0SD 2HXCD 2AH0D 2GC4B 2HKRD 3L4OC 2AGXD 2IUVD 2AGYD 1MG2B 2IUPD 2OIZD 2BBKL 1MDAM 2MADL 3C75L 2HKMD 2IUQD 2H47B 2IAAB 2J56L 2AH1D
chains in the KnotProt database with same CATH superfamily
2J57K 2Q7QD 2MTAL 2GC7B 2HJBD 2HJ4D 2OK4D 2IURD 1MG3B 2H3XB 2I0TD 2AGLD 2AGWD 2J55L 2OJYD 2I0SD 2HXCD 2AH0D 2GC4B 2HKRD 3L4OC 2AGXD 2IUVD 2AGYD 1MG2B 2IUPD 2OIZD 2BBKL 1MDAM 2MADL 3C75L 2HKMD 2IUQD 2H47B 2IAAB 2J56L 2AH1D
chains in the KnotProt database with same CATH topology
2J57K 2Q7QD 2MTAL 2GC7B 2HJBD 2HJ4D 2OK4D 2IURD 1MG3B 2H3XB 2I0TD 2AGLD 2AGWD 2J55L 2OJYD 2I0SD 2HXCD 2AH0D 2GC4B 2HKRD 3L4OC 2AGXD 2IUVD 2AGYD 1MG2B 2IUPD 2OIZD 2BBKL 1MDAM 2MADL 3C75L 2HKMD 2IUQD 2H47B 2IAAB 2J56L 2AH1D
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2J57 K;  2Q7Q D;  2MTA L;  2GC7 B;  2HJB D;  2HJ4 D;  2OK4 D;  2IUR D;  1MG3 B;  2H3X B;  2I0T D;  2AGL D;  2AGW D;  2J55 L;  2OJY D;  2I0S D;  2HXC D;  2AH0 D;  2GC4 B;  2HKR D;  3L4O C;  2AGX D;  2IUV D;  2AGY D;  1MG2 B;  2IUP D;  2OIZ D;  2BBK L;  1MDA M;  2MAD L;  3C75 L;  2HKM D;  2IUQ D;  2H47 B;  2IAA B;  2J56 L;  2AH1 D; 
#chains in the KnotProt database with same CATH topology
 2J57 K;  2Q7Q D;  2MTA L;  2GC7 B;  2HJB D;  2HJ4 D;  2OK4 D;  2IUR D;  1MG3 B;  2H3X B;  2I0T D;  2AGL D;  2AGW D;  2J55 L;  2OJY D;  2I0S D;  2HXC D;  2AH0 D;  2GC4 B;  2HKR D;  3L4O C;  2AGX D;  2IUV D;  2AGY D;  1MG2 B;  2IUP D;  2OIZ D;  2BBK L;  1MDA M;  2MAD L;  3C75 L;  2HKM D;  2IUQ D;  2H47 B;  2IAA B;  2J56 L;  2AH1 D; 
#chains in the KnotProt database with same CATH homology
 2J57 K;  2Q7Q D;  2MTA L;  2GC7 B;  2HJB D;  2HJ4 D;  2OK4 D;  2IUR D;  1MG3 B;  2H3X B;  2I0T D;  2AGL D;  2AGW D;  2J55 L;  2OJY D;  2I0S D;  2HXC D;  2AH0 D;  2GC4 B;  2HKR D;  3L4O C;  2AGX D;  2IUV D;  2AGY D;  1MG2 B;  2IUP D;  2OIZ D;  2BBK L;  1MDA M;  2MAD L;  3C75 L;  2HKM D;  2IUQ D;  2H47 B;  2IAA B;  2J56 L;  2AH1 D; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling