2I0SD

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 29-87 59 1-28, 88-97 28 10 knot
Fingerprint Knot forming loop Loop type
K +31 His59 ... Cys75 <-> Cys140 ... Cys113 <-> Cys81 ... Ttq109 <-> Trp160 ...
Chain closureAsn182 <-> His59
probabilistic
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 124
structure length 123
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
missing residues 51
total genus Genus: 34
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2i0sD00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2i0sD00
2AGWD 2J56L 2IURD 2GC4B 2I0SD 2OK4D 3L4OC 2Q7QD 3C75L 2OJYD 2MTAL 2HKRD 2H3XB 2AGLD 2J55L 2IUVD 2BBKL 1MDAM 2HJBD 2IUPD 2H47B 1MG2B 2HKMD 2I0TD 2J57K 2AH1D 2MADL 2HXCD 2HJ4D 2IAAB 2GC7B 2IUQD 2AGYD 2AH0D 2OIZD 2AGXD 1MG3B
chains in the KnotProt database with same CATH superfamily
2AGWD 2J56L 2IURD 2GC4B 2I0SD 2OK4D 3L4OC 2Q7QD 3C75L 2OJYD 2MTAL 2HKRD 2H3XB 2AGLD 2J55L 2IUVD 2BBKL 1MDAM 2HJBD 2IUPD 2H47B 1MG2B 2HKMD 2I0TD 2J57K 2AH1D 2MADL 2HXCD 2HJ4D 2IAAB 2GC7B 2IUQD 2AGYD 2AH0D 2OIZD 2AGXD 1MG3B
chains in the KnotProt database with same CATH topology
2AGWD 2J56L 2IURD 2GC4B 2I0SD 2OK4D 3L4OC 2Q7QD 3C75L 2OJYD 2MTAL 2HKRD 2H3XB 2AGLD 2J55L 2IUVD 2BBKL 1MDAM 2HJBD 2IUPD 2H47B 1MG2B 2HKMD 2I0TD 2J57K 2AH1D 2MADL 2HXCD 2HJ4D 2IAAB 2GC7B 2IUQD 2AGYD 2AH0D 2OIZD 2AGXD 1MG3B
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2AGW D;  2J56 L;  2IUR D;  2GC4 B;  2I0S D;  2OK4 D;  3L4O C;  2Q7Q D;  3C75 L;  2OJY D;  2MTA L;  2HKR D;  2H3X B;  2AGL D;  2J55 L;  2IUV D;  2BBK L;  1MDA M;  2HJB D;  2IUP D;  2H47 B;  1MG2 B;  2HKM D;  2I0T D;  2J57 K;  2AH1 D;  2MAD L;  2HXC D;  2HJ4 D;  2IAA B;  2GC7 B;  2IUQ D;  2AGY D;  2AH0 D;  2OIZ D;  2AGX D;  1MG3 B; 
#chains in the KnotProt database with same CATH topology
 2AGW D;  2J56 L;  2IUR D;  2GC4 B;  2I0S D;  2OK4 D;  3L4O C;  2Q7Q D;  3C75 L;  2OJY D;  2MTA L;  2HKR D;  2H3X B;  2AGL D;  2J55 L;  2IUV D;  2BBK L;  1MDA M;  2HJB D;  2IUP D;  2H47 B;  1MG2 B;  2HKM D;  2I0T D;  2J57 K;  2AH1 D;  2MAD L;  2HXC D;  2HJ4 D;  2IAA B;  2GC7 B;  2IUQ D;  2AGY D;  2AH0 D;  2OIZ D;  2AGX D;  1MG3 B; 
#chains in the KnotProt database with same CATH homology
 2AGW D;  2J56 L;  2IUR D;  2GC4 B;  2I0S D;  2OK4 D;  3L4O C;  2Q7Q D;  3C75 L;  2OJY D;  2MTA L;  2HKR D;  2H3X B;  2AGL D;  2J55 L;  2IUV D;  2BBK L;  1MDA M;  2HJB D;  2IUP D;  2H47 B;  1MG2 B;  2HKM D;  2I0T D;  2J57 K;  2AH1 D;  2MAD L;  2HXC D;  2HJ4 D;  2IAA B;  2GC7 B;  2IUQ D;  2AGY D;  2AH0 D;  2OIZ D;  2AGX D;  1MG3 B; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling