2HKMD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with phenylethylamine.
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 17-74 58 1-16, 75-83 16 9 knot
Fingerprint Knot forming loop Loop type
K +31 Glu71 ... Cys75 <-> Cys140 ... Cys113 <-> Cys81 ... Trq109 <-> Trp160 ...
Chain closureAla180 <-> Glu71
probabilistic
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 110
structure length 109
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
missing residues 39
total genus Genus: 27
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2hkmD00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2hkmD00
2IUQD 2IUPD 2H47B 2OJYD 2J57K 2AGXD 2OK4D 2IUVD 2HJ4D 2BBKL 2OIZD 2HKRD 2HKMD 2AGLD 1MDAM 2AGYD 2I0TD 2Q7QD 2IAAB 2I0SD 1MG3B 1MG2B 2H3XB 2GC4B 2HJBD 2J55L 2HXCD 2MADL 3C75L 2AGWD 2IURD 2MTAL 2AH0D 3L4OC 2AH1D 2GC7B 2J56L
chains in the KnotProt database with same CATH superfamily
2IUQD 2IUPD 2H47B 2OJYD 2J57K 2AGXD 2OK4D 2IUVD 2HJ4D 2BBKL 2OIZD 2HKRD 2HKMD 2AGLD 1MDAM 2AGYD 2I0TD 2Q7QD 2IAAB 2I0SD 1MG3B 1MG2B 2H3XB 2GC4B 2HJBD 2J55L 2HXCD 2MADL 3C75L 2AGWD 2IURD 2MTAL 2AH0D 3L4OC 2AH1D 2GC7B 2J56L
chains in the KnotProt database with same CATH topology
2IUQD 2IUPD 2H47B 2OJYD 2J57K 2AGXD 2OK4D 2IUVD 2HJ4D 2BBKL 2OIZD 2HKRD 2HKMD 2AGLD 1MDAM 2AGYD 2I0TD 2Q7QD 2IAAB 2I0SD 1MG3B 1MG2B 2H3XB 2GC4B 2HJBD 2J55L 2HXCD 2MADL 3C75L 2AGWD 2IURD 2MTAL 2AH0D 3L4OC 2AH1D 2GC7B 2J56L
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2IUQ D;  2IUP D;  2H47 B;  2OJY D;  2J57 K;  2AGX D;  2OK4 D;  2IUV D;  2HJ4 D;  2BBK L;  2OIZ D;  2HKR D;  2HKM D;  2AGL D;  1MDA M;  2AGY D;  2I0T D;  2Q7Q D;  2IAA B;  2I0S D;  1MG3 B;  1MG2 B;  2H3X B;  2GC4 B;  2HJB D;  2J55 L;  2HXC D;  2MAD L;  3C75 L;  2AGW D;  2IUR D;  2MTA L;  2AH0 D;  3L4O C;  2AH1 D;  2GC7 B;  2J56 L; 
#chains in the KnotProt database with same CATH topology
 2IUQ D;  2IUP D;  2H47 B;  2OJY D;  2J57 K;  2AGX D;  2OK4 D;  2IUV D;  2HJ4 D;  2BBK L;  2OIZ D;  2HKR D;  2HKM D;  2AGL D;  1MDA M;  2AGY D;  2I0T D;  2Q7Q D;  2IAA B;  2I0S D;  1MG3 B;  1MG2 B;  2H3X B;  2GC4 B;  2HJB D;  2J55 L;  2HXC D;  2MAD L;  3C75 L;  2AGW D;  2IUR D;  2MTA L;  2AH0 D;  3L4O C;  2AH1 D;  2GC7 B;  2J56 L; 
#chains in the KnotProt database with same CATH homology
 2IUQ D;  2IUP D;  2H47 B;  2OJY D;  2J57 K;  2AGX D;  2OK4 D;  2IUV D;  2HJ4 D;  2BBK L;  2OIZ D;  2HKR D;  2HKM D;  2AGL D;  1MDA M;  2AGY D;  2I0T D;  2Q7Q D;  2IAA B;  2I0S D;  1MG3 B;  1MG2 B;  2H3X B;  2GC4 B;  2HJB D;  2J55 L;  2HXC D;  2MAD L;  3C75 L;  2AGW D;  2IUR D;  2MTA L;  2AH0 D;  3L4O C;  2AH1 D;  2GC7 B;  2J56 L; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling