2Q7QD

Crystal structure of alcaligenes faecalis aadh in complex with p-chlorobenzylamine.
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 17-74 58 1-16, 75-82 16 8 knot
Fingerprint Knot forming loop Loop type
K +31 Glu71 ... Cys75 <-> Cys140 ... Cys113 <-> Cys81 ... Trq109 <-> Trp160 ...
Chain closureLeu179 <-> Glu71
probabilistic
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 109
structure length 108
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aralkylamine dehydrogenase light chain
source organism Alcaligenes faecalis
missing residues 39
total genus Genus: 24
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-06-07
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2q7qD00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2q7qD00
1MDAM 2HXCD 2HKRD 2AGXD 2GC4B 2IUQD 3L4OC 2OIZD 2BBKL 2I0TD 2OJYD 2AH0D 2I0SD 2Q7QD 2J57K 2OK4D 3C75L 2AGWD 2AGYD 2IUVD 2GC7B 2AH1D 2HKMD 2AGLD 2J56L 2J55L 2H47B 2IAAB 2MADL 2HJBD 1MG3B 2MTAL 1MG2B 2H3XB 2HJ4D 2IURD 2IUPD
chains in the KnotProt database with same CATH superfamily
1MDAM 2HXCD 2HKRD 2AGXD 2GC4B 2IUQD 3L4OC 2OIZD 2BBKL 2I0TD 2OJYD 2AH0D 2I0SD 2Q7QD 2J57K 2OK4D 3C75L 2AGWD 2AGYD 2IUVD 2GC7B 2AH1D 2HKMD 2AGLD 2J56L 2J55L 2H47B 2IAAB 2MADL 2HJBD 1MG3B 2MTAL 1MG2B 2H3XB 2HJ4D 2IURD 2IUPD
chains in the KnotProt database with same CATH topology
1MDAM 2HXCD 2HKRD 2AGXD 2GC4B 2IUQD 3L4OC 2OIZD 2BBKL 2I0TD 2OJYD 2AH0D 2I0SD 2Q7QD 2J57K 2OK4D 3C75L 2AGWD 2AGYD 2IUVD 2GC7B 2AH1D 2HKMD 2AGLD 2J56L 2J55L 2H47B 2IAAB 2MADL 2HJBD 1MG3B 2MTAL 1MG2B 2H3XB 2HJ4D 2IURD 2IUPD
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1MDA M;  2HXC D;  2HKR D;  2AGX D;  2GC4 B;  2IUQ D;  3L4O C;  2OIZ D;  2BBK L;  2I0T D;  2OJY D;  2AH0 D;  2I0S D;  2Q7Q D;  2J57 K;  2OK4 D;  3C75 L;  2AGW D;  2AGY D;  2IUV D;  2GC7 B;  2AH1 D;  2HKM D;  2AGL D;  2J56 L;  2J55 L;  2H47 B;  2IAA B;  2MAD L;  2HJB D;  1MG3 B;  2MTA L;  1MG2 B;  2H3X B;  2HJ4 D;  2IUR D;  2IUP D; 
#chains in the KnotProt database with same CATH topology
 1MDA M;  2HXC D;  2HKR D;  2AGX D;  2GC4 B;  2IUQ D;  3L4O C;  2OIZ D;  2BBK L;  2I0T D;  2OJY D;  2AH0 D;  2I0S D;  2Q7Q D;  2J57 K;  2OK4 D;  3C75 L;  2AGW D;  2AGY D;  2IUV D;  2GC7 B;  2AH1 D;  2HKM D;  2AGL D;  2J56 L;  2J55 L;  2H47 B;  2IAA B;  2MAD L;  2HJB D;  1MG3 B;  2MTA L;  1MG2 B;  2H3X B;  2HJ4 D;  2IUR D;  2IUP D; 
#chains in the KnotProt database with same CATH homology
 1MDA M;  2HXC D;  2HKR D;  2AGX D;  2GC4 B;  2IUQ D;  3L4O C;  2OIZ D;  2BBK L;  2I0T D;  2OJY D;  2AH0 D;  2I0S D;  2Q7Q D;  2J57 K;  2OK4 D;  3C75 L;  2AGW D;  2AGY D;  2IUV D;  2GC7 B;  2AH1 D;  2HKM D;  2AGL D;  2J56 L;  2J55 L;  2H47 B;  2IAA B;  2MAD L;  2HJB D;  1MG3 B;  2MTA L;  1MG2 B;  2H3X B;  2HJ4 D;  2IUR D;  2IUP D; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling