2H47B

Crystal structure of an electron transfer complex between aromatic amine dephydrogenase and azurin from alcaligenes faecalis (form 1)
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 29-86 58 1-28, 87-97 28 11 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis12 <-> Asn135
... Trp113 <-> Trq62 ... Cys34 <-> Cys66 ... Cys93 <-> Cys28 ... His12
probabilistic
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN
sequence length 124
structure length 123
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
molecule keywords Aromatic Amine Dehydrogenase
missing residues 51
total genus Genus: 30
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-05-23
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2h47B00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2h47B00
2HKMD 2Q7QD 2J55L 2H3XB 2H47B 2AGYD 2IUVD 2OIZD 2IURD 2OJYD 2IUPD 3L4OC 2I0SD 2GC7B 2HKRD 2AH1D 2J56L 2AGXD 2I0TD 2OK4D 2HJ4D 2HJBD 2BBKL 2GC4B 2IUQD 1MG2B 2HXCD 1MDAM 3C75L 2J57K 2MADL 2IAAB 1MG3B 2AGLD 2AGWD 2MTAL 2AH0D
chains in the KnotProt database with same CATH superfamily
2HKMD 2Q7QD 2J55L 2H3XB 2H47B 2AGYD 2IUVD 2OIZD 2IURD 2OJYD 2IUPD 3L4OC 2I0SD 2GC7B 2HKRD 2AH1D 2J56L 2AGXD 2I0TD 2OK4D 2HJ4D 2HJBD 2BBKL 2GC4B 2IUQD 1MG2B 2HXCD 1MDAM 3C75L 2J57K 2MADL 2IAAB 1MG3B 2AGLD 2AGWD 2MTAL 2AH0D
chains in the KnotProt database with same CATH topology
2HKMD 2Q7QD 2J55L 2H3XB 2H47B 2AGYD 2IUVD 2OIZD 2IURD 2OJYD 2IUPD 3L4OC 2I0SD 2GC7B 2HKRD 2AH1D 2J56L 2AGXD 2I0TD 2OK4D 2HJ4D 2HJBD 2BBKL 2GC4B 2IUQD 1MG2B 2HXCD 1MDAM 3C75L 2J57K 2MADL 2IAAB 1MG3B 2AGLD 2AGWD 2MTAL 2AH0D
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2HKM D;  2Q7Q D;  2J55 L;  2H3X B;  2H47 B;  2AGY D;  2IUV D;  2OIZ D;  2IUR D;  2OJY D;  2IUP D;  3L4O C;  2I0S D;  2GC7 B;  2HKR D;  2AH1 D;  2J56 L;  2AGX D;  2I0T D;  2OK4 D;  2HJ4 D;  2HJB D;  2BBK L;  2GC4 B;  2IUQ D;  1MG2 B;  2HXC D;  1MDA M;  3C75 L;  2J57 K;  2MAD L;  2IAA B;  1MG3 B;  2AGL D;  2AGW D;  2MTA L;  2AH0 D; 
#chains in the KnotProt database with same CATH topology
 2HKM D;  2Q7Q D;  2J55 L;  2H3X B;  2H47 B;  2AGY D;  2IUV D;  2OIZ D;  2IUR D;  2OJY D;  2IUP D;  3L4O C;  2I0S D;  2GC7 B;  2HKR D;  2AH1 D;  2J56 L;  2AGX D;  2I0T D;  2OK4 D;  2HJ4 D;  2HJB D;  2BBK L;  2GC4 B;  2IUQ D;  1MG2 B;  2HXC D;  1MDA M;  3C75 L;  2J57 K;  2MAD L;  2IAA B;  1MG3 B;  2AGL D;  2AGW D;  2MTA L;  2AH0 D; 
#chains in the KnotProt database with same CATH homology
 2HKM D;  2Q7Q D;  2J55 L;  2H3X B;  2H47 B;  2AGY D;  2IUV D;  2OIZ D;  2IUR D;  2OJY D;  2IUP D;  3L4O C;  2I0S D;  2GC7 B;  2HKR D;  2AH1 D;  2J56 L;  2AGX D;  2I0T D;  2OK4 D;  2HJ4 D;  2HJB D;  2BBK L;  2GC4 B;  2IUQ D;  1MG2 B;  2HXC D;  1MDA M;  3C75 L;  2J57 K;  2MAD L;  2IAA B;  1MG3 B;  2AGL D;  2AGW D;  2MTA L;  2AH0 D; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling