2H3XB

Crystal structure of an electron transfer complex between aromatic amine dehydrogenase and azurin from alcaligenes faecalis (form 3)
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 30-88 59 1-29, 89-98 29 10 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureAla10 <-> Lys134
... Trp113 <-> Trq62 ... Cys34 <-> Cys66 ... Cys93 <-> Cys28 ... Ala10
probabilistic
Chain Sequence
ADHISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAK
sequence length 125
structure length 124
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
molecule keywords Aromatic Amine Dehydrogenase
missing residues 53
total genus Genus: 31
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-05-23
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2h3xB00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2h3xB00
2HJ4D 2OJYD 2GC4B 1MDAM 2I0SD 2H3XB 2J56L 2IUQD 2IAAB 2J55L 1MG3B 2MTAL 2OK4D 2HXCD 2IUVD 2MADL 2HKRD 3L4OC 2IUPD 2AH0D 2AGYD 2HKMD 2IURD 2AGXD 2I0TD 2H47B 2Q7QD 2AGWD 2AH1D 2AGLD 2GC7B 3C75L 2BBKL 2HJBD 1MG2B 2OIZD 2J57K
chains in the KnotProt database with same CATH superfamily
2HJ4D 2OJYD 2GC4B 1MDAM 2I0SD 2H3XB 2J56L 2IUQD 2IAAB 2J55L 1MG3B 2MTAL 2OK4D 2HXCD 2IUVD 2MADL 2HKRD 3L4OC 2IUPD 2AH0D 2AGYD 2HKMD 2IURD 2AGXD 2I0TD 2H47B 2Q7QD 2AGWD 2AH1D 2AGLD 2GC7B 3C75L 2BBKL 2HJBD 1MG2B 2OIZD 2J57K
chains in the KnotProt database with same CATH topology
2HJ4D 2OJYD 2GC4B 1MDAM 2I0SD 2H3XB 2J56L 2IUQD 2IAAB 2J55L 1MG3B 2MTAL 2OK4D 2HXCD 2IUVD 2MADL 2HKRD 3L4OC 2IUPD 2AH0D 2AGYD 2HKMD 2IURD 2AGXD 2I0TD 2H47B 2Q7QD 2AGWD 2AH1D 2AGLD 2GC7B 3C75L 2BBKL 2HJBD 1MG2B 2OIZD 2J57K
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2HJ4 D;  2OJY D;  2GC4 B;  1MDA M;  2I0S D;  2H3X B;  2J56 L;  2IUQ D;  2IAA B;  2J55 L;  1MG3 B;  2MTA L;  2OK4 D;  2HXC D;  2IUV D;  2MAD L;  2HKR D;  3L4O C;  2IUP D;  2AH0 D;  2AGY D;  2HKM D;  2IUR D;  2AGX D;  2I0T D;  2H47 B;  2Q7Q D;  2AGW D;  2AH1 D;  2AGL D;  2GC7 B;  3C75 L;  2BBK L;  2HJB D;  1MG2 B;  2OIZ D;  2J57 K; 
#chains in the KnotProt database with same CATH topology
 2HJ4 D;  2OJY D;  2GC4 B;  1MDA M;  2I0S D;  2H3X B;  2J56 L;  2IUQ D;  2IAA B;  2J55 L;  1MG3 B;  2MTA L;  2OK4 D;  2HXC D;  2IUV D;  2MAD L;  2HKR D;  3L4O C;  2IUP D;  2AH0 D;  2AGY D;  2HKM D;  2IUR D;  2AGX D;  2I0T D;  2H47 B;  2Q7Q D;  2AGW D;  2AH1 D;  2AGL D;  2GC7 B;  3C75 L;  2BBK L;  2HJB D;  1MG2 B;  2OIZ D;  2J57 K; 
#chains in the KnotProt database with same CATH homology
 2HJ4 D;  2OJY D;  2GC4 B;  1MDA M;  2I0S D;  2H3X B;  2J56 L;  2IUQ D;  2IAA B;  2J55 L;  1MG3 B;  2MTA L;  2OK4 D;  2HXC D;  2IUV D;  2MAD L;  2HKR D;  3L4O C;  2IUP D;  2AH0 D;  2AGY D;  2HKM D;  2IUR D;  2AGX D;  2I0T D;  2H47 B;  2Q7Q D;  2AGW D;  2AH1 D;  2AGL D;  2GC7 B;  3C75 L;  2BBK L;  2HJB D;  1MG2 B;  2OIZ D;  2J57 K; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling