1MG3B

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 29-88 60 1-28, 89-98 28 10 knot
Fingerprint Knot forming loop Loop type
K +31 Thr7 ... Cys23 <-> Cys88 ... Cys61 <-> Cys29 ... Trw57 <-> Trp108 ...
Chain closureSer131 <-> Thr7
probabilistic
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATAS-VASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
sequence length 125
structure length 124
publication title MUTATION OF ALPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methylamine dehydrogenase, heavy chain
source organism Paracoccus denitrificans
missing residues 51
total genus Genus: 30
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 1mg3B00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 1mg3B00
2I0SD 2H47B 2IURD 2J55L 2AGWD 2GC7B 2IUQD 1MG3B 2HJ4D 1MG2B 3L4OC 2GC4B 2J56L 2OIZD 2I0TD 2MADL 2AGXD 1MDAM 2HJBD 2MTAL 2H3XB 2AH1D 2BBKL 2OJYD 2HXCD 2AH0D 2AGLD 2J57K 2Q7QD 2HKMD 2AGYD 3C75L 2IUPD 2IUVD 2HKRD 2OK4D 2IAAB
chains in the KnotProt database with same CATH superfamily
2I0SD 2H47B 2IURD 2J55L 2AGWD 2GC7B 2IUQD 1MG3B 2HJ4D 1MG2B 3L4OC 2GC4B 2J56L 2OIZD 2I0TD 2MADL 2AGXD 1MDAM 2HJBD 2MTAL 2H3XB 2AH1D 2BBKL 2OJYD 2HXCD 2AH0D 2AGLD 2J57K 2Q7QD 2HKMD 2AGYD 3C75L 2IUPD 2IUVD 2HKRD 2OK4D 2IAAB
chains in the KnotProt database with same CATH topology
2I0SD 2H47B 2IURD 2J55L 2AGWD 2GC7B 2IUQD 1MG3B 2HJ4D 1MG2B 3L4OC 2GC4B 2J56L 2OIZD 2I0TD 2MADL 2AGXD 1MDAM 2HJBD 2MTAL 2H3XB 2AH1D 2BBKL 2OJYD 2HXCD 2AH0D 2AGLD 2J57K 2Q7QD 2HKMD 2AGYD 3C75L 2IUPD 2IUVD 2HKRD 2OK4D 2IAAB
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2I0S D;  2H47 B;  2IUR D;  2J55 L;  2AGW D;  2GC7 B;  2IUQ D;  1MG3 B;  2HJ4 D;  1MG2 B;  3L4O C;  2GC4 B;  2J56 L;  2OIZ D;  2I0T D;  2MAD L;  2AGX D;  1MDA M;  2HJB D;  2MTA L;  2H3X B;  2AH1 D;  2BBK L;  2OJY D;  2HXC D;  2AH0 D;  2AGL D;  2J57 K;  2Q7Q D;  2HKM D;  2AGY D;  3C75 L;  2IUP D;  2IUV D;  2HKR D;  2OK4 D;  2IAA B; 
#chains in the KnotProt database with same CATH topology
 2I0S D;  2H47 B;  2IUR D;  2J55 L;  2AGW D;  2GC7 B;  2IUQ D;  1MG3 B;  2HJ4 D;  1MG2 B;  3L4O C;  2GC4 B;  2J56 L;  2OIZ D;  2I0T D;  2MAD L;  2AGX D;  1MDA M;  2HJB D;  2MTA L;  2H3X B;  2AH1 D;  2BBK L;  2OJY D;  2HXC D;  2AH0 D;  2AGL D;  2J57 K;  2Q7Q D;  2HKM D;  2AGY D;  3C75 L;  2IUP D;  2IUV D;  2HKR D;  2OK4 D;  2IAA B; 
#chains in the KnotProt database with same CATH homology
 2I0S D;  2H47 B;  2IUR D;  2J55 L;  2AGW D;  2GC7 B;  2IUQ D;  1MG3 B;  2HJ4 D;  1MG2 B;  3L4O C;  2GC4 B;  2J56 L;  2OIZ D;  2I0T D;  2MAD L;  2AGX D;  1MDA M;  2HJB D;  2MTA L;  2H3X B;  2AH1 D;  2BBK L;  2OJY D;  2HXC D;  2AH0 D;  2AGL D;  2J57 K;  2Q7Q D;  2HKM D;  2AGY D;  3C75 L;  2IUP D;  2IUV D;  2HKR D;  2OK4 D;  2IAA B; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling