2AH1D

Crystal structure of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 17-75 59 1-16, 76-83 16 8 knot
Fingerprint Knot forming loop Loop type
K +31 Glu71 ... Cys75 <-> Cys140 ... Cys113 <-> Cys81 ... Trq109 <-> Trp160 ...
Chain closureAla180 <-> Glu71
probabilistic
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 110
structure length 109
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
missing residues 39
total genus Genus: 28
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2ah1D00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2ah1D00
1MDAM 2HXCD 2HKRD 2AGXD 2IUQD 2Q7QD 2IAAB 2OK4D 2AH0D 2IUVD 2J57K 2OIZD 1MG3B 2MADL 2J55L 2GC4B 2MTAL 2IUPD 2AGYD 2IURD 2HKMD 2I0TD 2HJBD 2H47B 2I0SD 2AGLD 2HJ4D 2AH1D 2J56L 2OJYD 2AGWD 2BBKL 2H3XB 3L4OC 1MG2B 3C75L 2GC7B
chains in the KnotProt database with same CATH superfamily
1MDAM 2HXCD 2HKRD 2AGXD 2IUQD 2Q7QD 2IAAB 2OK4D 2AH0D 2IUVD 2J57K 2OIZD 1MG3B 2MADL 2J55L 2GC4B 2MTAL 2IUPD 2AGYD 2IURD 2HKMD 2I0TD 2HJBD 2H47B 2I0SD 2AGLD 2HJ4D 2AH1D 2J56L 2OJYD 2AGWD 2BBKL 2H3XB 3L4OC 1MG2B 3C75L 2GC7B
chains in the KnotProt database with same CATH topology
1MDAM 2HXCD 2HKRD 2AGXD 2IUQD 2Q7QD 2IAAB 2OK4D 2AH0D 2IUVD 2J57K 2OIZD 1MG3B 2MADL 2J55L 2GC4B 2MTAL 2IUPD 2AGYD 2IURD 2HKMD 2I0TD 2HJBD 2H47B 2I0SD 2AGLD 2HJ4D 2AH1D 2J56L 2OJYD 2AGWD 2BBKL 2H3XB 3L4OC 1MG2B 3C75L 2GC7B
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1MDA M;  2HXC D;  2HKR D;  2AGX D;  2IUQ D;  2Q7Q D;  2IAA B;  2OK4 D;  2AH0 D;  2IUV D;  2J57 K;  2OIZ D;  1MG3 B;  2MAD L;  2J55 L;  2GC4 B;  2MTA L;  2IUP D;  2AGY D;  2IUR D;  2HKM D;  2I0T D;  2HJB D;  2H47 B;  2I0S D;  2AGL D;  2HJ4 D;  2AH1 D;  2J56 L;  2OJY D;  2AGW D;  2BBK L;  2H3X B;  3L4O C;  1MG2 B;  3C75 L;  2GC7 B; 
#chains in the KnotProt database with same CATH topology
 1MDA M;  2HXC D;  2HKR D;  2AGX D;  2IUQ D;  2Q7Q D;  2IAA B;  2OK4 D;  2AH0 D;  2IUV D;  2J57 K;  2OIZ D;  1MG3 B;  2MAD L;  2J55 L;  2GC4 B;  2MTA L;  2IUP D;  2AGY D;  2IUR D;  2HKM D;  2I0T D;  2HJB D;  2H47 B;  2I0S D;  2AGL D;  2HJ4 D;  2AH1 D;  2J56 L;  2OJY D;  2AGW D;  2BBK L;  2H3X B;  3L4O C;  1MG2 B;  3C75 L;  2GC7 B; 
#chains in the KnotProt database with same CATH homology
 1MDA M;  2HXC D;  2HKR D;  2AGX D;  2IUQ D;  2Q7Q D;  2IAA B;  2OK4 D;  2AH0 D;  2IUV D;  2J57 K;  2OIZ D;  1MG3 B;  2MAD L;  2J55 L;  2GC4 B;  2MTA L;  2IUP D;  2AGY D;  2IUR D;  2HKM D;  2I0T D;  2HJB D;  2H47 B;  2I0S D;  2AGL D;  2HJ4 D;  2AH1 D;  2J56 L;  2OJY D;  2AGW D;  2BBK L;  2H3X B;  3L4O C;  1MG2 B;  3C75 L;  2GC7 B; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling