2GC7B

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 28-88 61 1-27, 89-98 27 10 knot
Fingerprint Knot forming loop Loop type
K +31 Thr7 ... Cys23 <-> Cys88 ... Cys61 <-> Cys29 ... Trq57 <-> Trp108 ...
Chain closureSer131 <-> Thr7
probabilistic
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATAS-VASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
sequence length 125
structure length 124
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
missing residues 51
total genus Genus: 29
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2gc7B00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2gc7B00
2GC4B 2HJBD 2H47B 1MDAM 2AGWD 2J55L 2AH0D 2J57K 3L4OC 2AH1D 2HXCD 1MG3B 2HKRD 2J56L 2AGXD 2IURD 2OIZD 2AGYD 2OK4D 3C75L 2I0TD 2I0SD 2H3XB 2MTAL 2IAAB 2AGLD 2OJYD 2HJ4D 2IUQD 2GC7B 2HKMD 2Q7QD 1MG2B 2IUPD 2MADL 2BBKL 2IUVD
chains in the KnotProt database with same CATH superfamily
2GC4B 2HJBD 2H47B 1MDAM 2AGWD 2J55L 2AH0D 2J57K 3L4OC 2AH1D 2HXCD 1MG3B 2HKRD 2J56L 2AGXD 2IURD 2OIZD 2AGYD 2OK4D 3C75L 2I0TD 2I0SD 2H3XB 2MTAL 2IAAB 2AGLD 2OJYD 2HJ4D 2IUQD 2GC7B 2HKMD 2Q7QD 1MG2B 2IUPD 2MADL 2BBKL 2IUVD
chains in the KnotProt database with same CATH topology
2GC4B 2HJBD 2H47B 1MDAM 2AGWD 2J55L 2AH0D 2J57K 3L4OC 2AH1D 2HXCD 1MG3B 2HKRD 2J56L 2AGXD 2IURD 2OIZD 2AGYD 2OK4D 3C75L 2I0TD 2I0SD 2H3XB 2MTAL 2IAAB 2AGLD 2OJYD 2HJ4D 2IUQD 2GC7B 2HKMD 2Q7QD 1MG2B 2IUPD 2MADL 2BBKL 2IUVD
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2GC4 B;  2HJB D;  2H47 B;  1MDA M;  2AGW D;  2J55 L;  2AH0 D;  2J57 K;  3L4O C;  2AH1 D;  2HXC D;  1MG3 B;  2HKR D;  2J56 L;  2AGX D;  2IUR D;  2OIZ D;  2AGY D;  2OK4 D;  3C75 L;  2I0T D;  2I0S D;  2H3X B;  2MTA L;  2IAA B;  2AGL D;  2OJY D;  2HJ4 D;  2IUQ D;  2GC7 B;  2HKM D;  2Q7Q D;  1MG2 B;  2IUP D;  2MAD L;  2BBK L;  2IUV D; 
#chains in the KnotProt database with same CATH topology
 2GC4 B;  2HJB D;  2H47 B;  1MDA M;  2AGW D;  2J55 L;  2AH0 D;  2J57 K;  3L4O C;  2AH1 D;  2HXC D;  1MG3 B;  2HKR D;  2J56 L;  2AGX D;  2IUR D;  2OIZ D;  2AGY D;  2OK4 D;  3C75 L;  2I0T D;  2I0S D;  2H3X B;  2MTA L;  2IAA B;  2AGL D;  2OJY D;  2HJ4 D;  2IUQ D;  2GC7 B;  2HKM D;  2Q7Q D;  1MG2 B;  2IUP D;  2MAD L;  2BBK L;  2IUV D; 
#chains in the KnotProt database with same CATH homology
 2GC4 B;  2HJB D;  2H47 B;  1MDA M;  2AGW D;  2J55 L;  2AH0 D;  2J57 K;  3L4O C;  2AH1 D;  2HXC D;  1MG3 B;  2HKR D;  2J56 L;  2AGX D;  2IUR D;  2OIZ D;  2AGY D;  2OK4 D;  3C75 L;  2I0T D;  2I0S D;  2H3X B;  2MTA L;  2IAA B;  2AGL D;  2OJY D;  2HJ4 D;  2IUQ D;  2GC7 B;  2HKM D;  2Q7Q D;  1MG2 B;  2IUP D;  2MAD L;  2BBK L;  2IUV D; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling