2H3XB

Crystal structure of an electron transfer complex between aromatic amine dehydrogenase and azurin from alcaligenes faecalis (form 3)
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 30-88 59 1-29, 89-98 29 10 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureAla10 <-> Lys134
... Trp113 <-> Trq62 ... Cys34 <-> Cys66 ... Cys93 <-> Cys28 ... Ala10
probabilistic
Chain Sequence
ADHISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAK
missing residues 53
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
structure length 124
molecule tags Oxidoreductase/electron transport
sequence length 125
total genus Genus: 31
molecule keywords Aromatic Amine Dehydrogenase
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-05-23
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2h3xB00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2h3xB00
2J55L 1MG2B 2MTAL 2IUPD 2HKMD 2J56L 3C75L 2MADL 2GC7B 2H3XB 2H47B 2IURD 2AH1D 2OIZD 2AGWD 2AGYD 2GC4B 3L4OC 2BBKL 2OK4D 2HKRD 2HJBD 2Q7QD 2IAAB 2HJ4D 2J57K 2IUVD 2I0TD 2I0SD 2AGLD 2IUQD 2AH0D 1MDAM 2HXCD 2AGXD 2OJYD 1MG3B
chains in the KnotProt database with same CATH superfamily
2J55L 1MG2B 2MTAL 2IUPD 2HKMD 2J56L 3C75L 2MADL 2GC7B 2H3XB 2H47B 2IURD 2AH1D 2OIZD 2AGWD 2AGYD 2GC4B 3L4OC 2BBKL 2OK4D 2HKRD 2HJBD 2Q7QD 2IAAB 2HJ4D 2J57K 2IUVD 2I0TD 2I0SD 2AGLD 2IUQD 2AH0D 1MDAM 2HXCD 2AGXD 2OJYD 1MG3B
chains in the KnotProt database with same CATH topology
2J55L 1MG2B 2MTAL 2IUPD 2HKMD 2J56L 3C75L 2MADL 2GC7B 2H3XB 2H47B 2IURD 2AH1D 2OIZD 2AGWD 2AGYD 2GC4B 3L4OC 2BBKL 2OK4D 2HKRD 2HJBD 2Q7QD 2IAAB 2HJ4D 2J57K 2IUVD 2I0TD 2I0SD 2AGLD 2IUQD 2AH0D 1MDAM 2HXCD 2AGXD 2OJYD 1MG3B
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2J55 L;  1MG2 B;  2MTA L;  2IUP D;  2HKM D;  2J56 L;  3C75 L;  2MAD L;  2GC7 B;  2H3X B;  2H47 B;  2IUR D;  2AH1 D;  2OIZ D;  2AGW D;  2AGY D;  2GC4 B;  3L4O C;  2BBK L;  2OK4 D;  2HKR D;  2HJB D;  2Q7Q D;  2IAA B;  2HJ4 D;  2J57 K;  2IUV D;  2I0T D;  2I0S D;  2AGL D;  2IUQ D;  2AH0 D;  1MDA M;  2HXC D;  2AGX D;  2OJY D;  1MG3 B; 
#chains in the KnotProt database with same CATH topology
 2J55 L;  1MG2 B;  2MTA L;  2IUP D;  2HKM D;  2J56 L;  3C75 L;  2MAD L;  2GC7 B;  2H3X B;  2H47 B;  2IUR D;  2AH1 D;  2OIZ D;  2AGW D;  2AGY D;  2GC4 B;  3L4O C;  2BBK L;  2OK4 D;  2HKR D;  2HJB D;  2Q7Q D;  2IAA B;  2HJ4 D;  2J57 K;  2IUV D;  2I0T D;  2I0S D;  2AGL D;  2IUQ D;  2AH0 D;  1MDA M;  2HXC D;  2AGX D;  2OJY D;  1MG3 B; 
#chains in the KnotProt database with same CATH homology
 2J55 L;  1MG2 B;  2MTA L;  2IUP D;  2HKM D;  2J56 L;  3C75 L;  2MAD L;  2GC7 B;  2H3X B;  2H47 B;  2IUR D;  2AH1 D;  2OIZ D;  2AGW D;  2AGY D;  2GC4 B;  3L4O C;  2BBK L;  2OK4 D;  2HKR D;  2HJB D;  2Q7Q D;  2IAA B;  2HJ4 D;  2J57 K;  2IUV D;  2I0T D;  2I0S D;  2AGL D;  2IUQ D;  2AH0 D;  1MDA M;  2HXC D;  2AGX D;  2OJY D;  1MG3 B; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling