2IUPD

Crystal structure of dithionite-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 16-75 60 1-15, 76-82 15 7 knot
Fingerprint Knot forming loop Loop type
K +31 Glu71 ... Cys75 <-> Cys140 ... Cys113 <-> Cys81 ... Trq109 <-> Trp160 ...
Chain closureLeu179 <-> Glu71
probabilistic
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 109
structure length 108
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
missing residues 39
total genus Genus: 26
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2iupD00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2iupD00
2AGXD 2IAAB 2OJYD 2HXCD 2IUPD 2BBKL 2AH0D 2IUQD 2Q7QD 2HJ4D 2I0TD 2HKMD 3L4OC 2MTAL 2I0SD 2HJBD 2HKRD 2J55L 2GC4B 2MADL 2OIZD 1MDAM 2IUVD 2AGYD 2GC7B 1MG2B 2IURD 2J56L 2AH1D 2H3XB 2OK4D 2AGLD 2J57K 2AGWD 1MG3B 2H47B 3C75L
chains in the KnotProt database with same CATH superfamily
2AGXD 2IAAB 2OJYD 2HXCD 2IUPD 2BBKL 2AH0D 2IUQD 2Q7QD 2HJ4D 2I0TD 2HKMD 3L4OC 2MTAL 2I0SD 2HJBD 2HKRD 2J55L 2GC4B 2MADL 2OIZD 1MDAM 2IUVD 2AGYD 2GC7B 1MG2B 2IURD 2J56L 2AH1D 2H3XB 2OK4D 2AGLD 2J57K 2AGWD 1MG3B 2H47B 3C75L
chains in the KnotProt database with same CATH topology
2AGXD 2IAAB 2OJYD 2HXCD 2IUPD 2BBKL 2AH0D 2IUQD 2Q7QD 2HJ4D 2I0TD 2HKMD 3L4OC 2MTAL 2I0SD 2HJBD 2HKRD 2J55L 2GC4B 2MADL 2OIZD 1MDAM 2IUVD 2AGYD 2GC7B 1MG2B 2IURD 2J56L 2AH1D 2H3XB 2OK4D 2AGLD 2J57K 2AGWD 1MG3B 2H47B 3C75L
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2AGX D;  2IAA B;  2OJY D;  2HXC D;  2IUP D;  2BBK L;  2AH0 D;  2IUQ D;  2Q7Q D;  2HJ4 D;  2I0T D;  2HKM D;  3L4O C;  2MTA L;  2I0S D;  2HJB D;  2HKR D;  2J55 L;  2GC4 B;  2MAD L;  2OIZ D;  1MDA M;  2IUV D;  2AGY D;  2GC7 B;  1MG2 B;  2IUR D;  2J56 L;  2AH1 D;  2H3X B;  2OK4 D;  2AGL D;  2J57 K;  2AGW D;  1MG3 B;  2H47 B;  3C75 L; 
#chains in the KnotProt database with same CATH topology
 2AGX D;  2IAA B;  2OJY D;  2HXC D;  2IUP D;  2BBK L;  2AH0 D;  2IUQ D;  2Q7Q D;  2HJ4 D;  2I0T D;  2HKM D;  3L4O C;  2MTA L;  2I0S D;  2HJB D;  2HKR D;  2J55 L;  2GC4 B;  2MAD L;  2OIZ D;  1MDA M;  2IUV D;  2AGY D;  2GC7 B;  1MG2 B;  2IUR D;  2J56 L;  2AH1 D;  2H3X B;  2OK4 D;  2AGL D;  2J57 K;  2AGW D;  1MG3 B;  2H47 B;  3C75 L; 
#chains in the KnotProt database with same CATH homology
 2AGX D;  2IAA B;  2OJY D;  2HXC D;  2IUP D;  2BBK L;  2AH0 D;  2IUQ D;  2Q7Q D;  2HJ4 D;  2I0T D;  2HKM D;  3L4O C;  2MTA L;  2I0S D;  2HJB D;  2HKR D;  2J55 L;  2GC4 B;  2MAD L;  2OIZ D;  1MDA M;  2IUV D;  2AGY D;  2GC7 B;  1MG2 B;  2IUR D;  2J56 L;  2AH1 D;  2H3X B;  2OK4 D;  2AGL D;  2J57 K;  2AGW D;  1MG3 B;  2H47 B;  3C75 L; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling