2J57K

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 28-88 61 1-27, 89-98 27 10 knot
Fingerprint Knot forming loop Loop type
K +31 Thr7 ... Cys23 <-> Cys88 ... Cys61 <-> Cys29 ... Tqq57 <-> Trp108 ...
Chain closureSer131 <-> Thr7
probabilistic
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATAS-VASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
sequence length 125
structure length 124
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AMICYANIN
missing residues 51
total genus Genus: 32
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2j57K00
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Electron Transport Ethylamine Dehydrogenase 2j57K00
2HKMD 2J57K 2H3XB 2I0TD 2IUVD 2OJYD 2MTAL 2MADL 2GC7B 2AGLD 2IUQD 2IUPD 3L4OC 1MDAM 2J56L 2AH0D 1MG3B 2BBKL 2H47B 2AH1D 1MG2B 2I0SD 2AGWD 2J55L 2GC4B 2Q7QD 2AGXD 2IURD 2HKRD 3C75L 2AGYD 2HXCD 2HJBD 2OIZD 2IAAB 2HJ4D 2OK4D
chains in the KnotProt database with same CATH superfamily
2HKMD 2J57K 2H3XB 2I0TD 2IUVD 2OJYD 2MTAL 2MADL 2GC7B 2AGLD 2IUQD 2IUPD 3L4OC 1MDAM 2J56L 2AH0D 1MG3B 2BBKL 2H47B 2AH1D 1MG2B 2I0SD 2AGWD 2J55L 2GC4B 2Q7QD 2AGXD 2IURD 2HKRD 3C75L 2AGYD 2HXCD 2HJBD 2OIZD 2IAAB 2HJ4D 2OK4D
chains in the KnotProt database with same CATH topology
2HKMD 2J57K 2H3XB 2I0TD 2IUVD 2OJYD 2MTAL 2MADL 2GC7B 2AGLD 2IUQD 2IUPD 3L4OC 1MDAM 2J56L 2AH0D 1MG3B 2BBKL 2H47B 2AH1D 1MG2B 2I0SD 2AGWD 2J55L 2GC4B 2Q7QD 2AGXD 2IURD 2HKRD 3C75L 2AGYD 2HXCD 2HJBD 2OIZD 2IAAB 2HJ4D 2OK4D
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2HKM D;  2J57 K;  2H3X B;  2I0T D;  2IUV D;  2OJY D;  2MTA L;  2MAD L;  2GC7 B;  2AGL D;  2IUQ D;  2IUP D;  3L4O C;  1MDA M;  2J56 L;  2AH0 D;  1MG3 B;  2BBK L;  2H47 B;  2AH1 D;  1MG2 B;  2I0S D;  2AGW D;  2J55 L;  2GC4 B;  2Q7Q D;  2AGX D;  2IUR D;  2HKR D;  3C75 L;  2AGY D;  2HXC D;  2HJB D;  2OIZ D;  2IAA B;  2HJ4 D;  2OK4 D; 
#chains in the KnotProt database with same CATH topology
 2HKM D;  2J57 K;  2H3X B;  2I0T D;  2IUV D;  2OJY D;  2MTA L;  2MAD L;  2GC7 B;  2AGL D;  2IUQ D;  2IUP D;  3L4O C;  1MDA M;  2J56 L;  2AH0 D;  1MG3 B;  2BBK L;  2H47 B;  2AH1 D;  1MG2 B;  2I0S D;  2AGW D;  2J55 L;  2GC4 B;  2Q7Q D;  2AGX D;  2IUR D;  2HKR D;  3C75 L;  2AGY D;  2HXC D;  2HJB D;  2OIZ D;  2IAA B;  2HJ4 D;  2OK4 D; 
#chains in the KnotProt database with same CATH homology
 2HKM D;  2J57 K;  2H3X B;  2I0T D;  2IUV D;  2OJY D;  2MTA L;  2MAD L;  2GC7 B;  2AGL D;  2IUQ D;  2IUP D;  3L4O C;  1MDA M;  2J56 L;  2AH0 D;  1MG3 B;  2BBK L;  2H47 B;  2AH1 D;  1MG2 B;  2I0S D;  2AGW D;  2J55 L;  2GC4 B;  2Q7Q D;  2AGX D;  2IUR D;  2HKR D;  3C75 L;  2AGY D;  2HXC D;  2HJB D;  2OIZ D;  2IAA B;  2HJ4 D;  2OK4 D; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling