1DBIA

Crystal structure of a thermostable serine protease
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 100x -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
- 31 36-79 44 1-35, 80-81 35 2 knot
Fingerprint Knot forming loop Loop type
K -31 Asp5 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Asp5
ion-based
K -31 Asp5 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Asp5
ion-based
K -31 Asp5 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Asp5
ion-based
K -31 Asp5 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asp5
ion-based
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
Chain Sequence
WTPNDTYYQGYQYGPQNTYTDYAWDVTKGSSGQEIAVIDTGVDYTHPDLDGKVIKGYDFVDNDYDPMDLNNHGTHVAGIAAAETNNATGIAGMAPNTRILAVRALDRNGSGTLSDIADAIIYAADSGAEVINLSLGCDCHTTTLENAVNYAWNKGSVVVAAAGNN---------SYENVIAVGAVDQYDRLASFSNYGTWVDVVAPGVDIVSTITGNRYAYMSGTSMASPHVAGLAALLASQGRNNIEIRQAIEQTADKISGTGTYFKYGRINSYNAVTY
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 280
structure length 271
publication title Calcium-mediated thermostability in the subtilisin superfamily: the crystal structure of Bacillus Ak.1 protease at 1.8 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords AK.1 SERINE PROTEASE
missing residues 166-174
total genus Genus: 106
ec nomenclature
pdb deposition date 1999-11-02
KnotProt deposition date 2018-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dbiA00
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1dbiA00
2XTJA 1DBIA
chains in the KnotProt database with same CATH superfamily
3L06A 1OF1A 3L02A 1QHIA 3M4JA 3FSGA 3FR8A 1JS1X 1YH1A 3VTKA 1II9A 1E2LA 3RDPA 3L04A 1P6XA 1E2JA 1E2IA 2XTJA 1KIMA 4IVQA 3M4NA 1GKUB 1QMGA 4IVPA 1KI7A 1KI2A 3L05A 1YVEI 2FG6C 1E2NA 2VTKA 4JBXA 1P75A 1KI6A 1E2KA 3M5CA 3M5DA 3FR7A 1E2PA 1OSNA 1YRLA 3KZCA 1F48A 1P7CA 1R4MB 1R4NB 1DBIA 3F0TA 3KZMA 2KI5A 3KZKA 1E2MA 1KI6B 4IVRA 1P72A 2G7MC 4JBYA 1KI3A 1LNSA 1VTKA 3KZOA 1E2HA 1KI8A 3KZNA 1P73A 1KI4A
chains in the KnotProt database with same CATH topology
3L06A 3L02A 3M4JA 3FSGA 1JS1X 1YH1A 3L04A 2XTJA 3M4NA 1GKUB 3L05A 2FG6C 3M5DA 3M5CA 3KZCA 1DBIA 3KZMA 3KZKA 2G7MC 1LNSA 3KZOA 3KZNA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2XTJ A;  1DBI A; 
#chains in the KnotProt database with same CATH topology
 3L06 A;  1OF1 A;  3L02 A;  1QHI A;  3M4J A;  3FSG A;  3FR8 A;  1JS1 X;  1YH1 A;  3VTK A;  1II9 A;  1E2L A;  3RDP A;  3L04 A;  1P6X A;  1E2J A;  1E2I A;  2XTJ A;  1KIM A;  4IVQ A;  3M4N A;  1GKU B;  1QMG A;  4IVP A;  1KI7 A;  1KI2 A;  3L05 A;  1YVE I;  2FG6 C;  1E2N A;  2VTK A;  4JBX A;  1P75 A;  1KI6 A;  1E2K A;  3M5C A;  3M5D A;  3FR7 A;  1E2P A;  1OSN A;  1YRL A;  3KZC A;  1F48 A;  1P7C A;  1R4M B;  1R4N B;  1DBI A;  3F0T A;  3KZM A;  2KI5 A;  3KZK A;  1E2M A;  1KI6 B;  4IVR A;  1P72 A;  2G7M C;  4JBY A;  1KI3 A;  1LNS A;  1VTK A;  3KZO A;  1E2H A;  1KI8 A;  3KZN A;  1P73 A;  1KI4 A; 
#chains in the KnotProt database with same CATH homology
 3L06 A;  3L02 A;  3M4J A;  3FSG A;  1JS1 X;  1YH1 A;  3L04 A;  2XTJ A;  3M4N A;  1GKU B;  3L05 A;  2FG6 C;  3M5D A;  3M5C A;  3KZC A;  1DBI A;  3KZM A;  3KZK A;  2G7M C;  1LNS A;  3KZO A;  3KZN A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling