1DBIA

Crystal structure of a thermostable serine protease
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 100x -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
- 31 36-79 44 1-35, 80-81 35 2 knot
Fingerprint Knot forming loop Loop type
K -31 Asp5 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Asp5
ion-based
K -31 Asp5 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Asp5
ion-based
K -31 Asp5 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Asp5
ion-based
K -31 Asp5 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asp5
ion-based
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Val179 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Val179 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp65 <->
Bridging ionCa703
<-> Asp63 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Asn86 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Ile90 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31 Trp1 ... Pro47 <->
Bridging ionCa704
<-> Glu83 ... Asp63 <->
Bridging ionCa703
<-> Asp58 ... Asp48 <->
Bridging ionCa701
<-> Thr88 ... Tyr176 <->
Bridging ionNa702
<-> Asp202 ...
Chain closureTyr280 <-> Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Val179 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Val179 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp63 <->
Bridging ionCa703
<-> Asp65 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Asn86 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Ile90 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
K -31
Chain closureTrp1 <-> Tyr280
... Asp202 <->
Bridging ionNa702
<-> Tyr176 ... Cys139 <-> Cys137 ... Thr88 <->
Bridging ionCa701
<-> Asp48 ... Asp58 <->
Bridging ionCa703
<-> Asp63 ... Glu83 <->
Bridging ionCa704
<-> Pro47 ... Trp1
probabilistic
Chain Sequence
WTPNDTYYQGYQYGPQNTYTDYAWDVTKGSSGQEIAVIDTGVDYTHPDLDGKVIKGYDFVDNDYDPMDLNNHGTHVAGIAAAETNNATGIAGMAPNTRILAVRALDRNGSGTLSDIADAIIYAADSGAEVINLSLGCDCHTTTLENAVNYAWNKGSVVVAAAGNN---------SYENVIAVGAVDQYDRLASFSNYGTWVDVVAPGVDIVSTITGNRYAYMSGTSMASPHVAGLAALLASQGRNNIEIRQAIEQTADKISGTGTYFKYGRINSYNAVTY
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 280
structure length 271
publication title Calcium-mediated thermostability in the subtilisin superfamily: the crystal structure of Bacillus Ak.1 protease at 1.8 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords AK.1 SERINE PROTEASE
missing residues 166-174
total genus Genus: 106
ec nomenclature
pdb deposition date 1999-11-02
KnotProt deposition date 2018-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dbiA00
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1dbiA00
2XTJA 1DBIA
chains in the KnotProt database with same CATH superfamily
1E2HA 1E2LA 1R4NB 3VTKA 4IVQA 3L04A 3M5DA 1P73A 3M4NA 1KIMA 1KI3A 4IVRA 3KZKA 3RDPA 3L02A 1YH1A 2FG7X 1E2KA 1E2PA 1DBIA 2G7MC 1KI2A 1KI6A 1OSNA 3FR8A 1QHIA 2KI5A 3KZMA 2FG7C 1KI6B 1II9A 3FR7A 2XTJA 1QMGA 1E2IA 3KZOA 1JS1X 3M4JA 2FG6C 1P75A 4JBYA 3KZNA 1R4MB 1LNSA 4IVPA 1YRLA 2VTKA 1OF1A 1P72A 1KI4A 1KI8A 1KI7A 1E2MA 3KZCA 3M5CA 1P6XA 1E2NA 4JBXA 1F48A 3L05A 1YVEI 1E2JA 3F0TA 3FSGA 1VTKA 1P7CA 3L06A 1GKUB
chains in the KnotProt database with same CATH topology
3L04A 3M5DA 3M4NA 3KZKA 3L02A 1YH1A 2FG7X 1DBIA 2G7MC 3KZMA 2FG7C 2XTJA 3KZOA 1JS1X 3M4JA 2FG6C 3KZNA 1LNSA 3KZCA 3M5CA 3L05A 3FSGA 3L06A 1GKUB
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2XTJ A;  1DBI A; 
#chains in the KnotProt database with same CATH topology
 1E2H A;  1E2L A;  1R4N B;  3VTK A;  4IVQ A;  3L04 A;  3M5D A;  1P73 A;  3M4N A;  1KIM A;  1KI3 A;  4IVR A;  3KZK A;  3RDP A;  3L02 A;  1YH1 A;  2FG7 X;  1E2K A;  1E2P A;  1DBI A;  2G7M C;  1KI2 A;  1KI6 A;  1OSN A;  3FR8 A;  1QHI A;  2KI5 A;  3KZM A;  2FG7 C;  1KI6 B;  1II9 A;  3FR7 A;  2XTJ A;  1QMG A;  1E2I A;  3KZO A;  1JS1 X;  3M4J A;  2FG6 C;  1P75 A;  4JBY A;  3KZN A;  1R4M B;  1LNS A;  4IVP A;  1YRL A;  2VTK A;  1OF1 A;  1P72 A;  1KI4 A;  1KI8 A;  1KI7 A;  1E2M A;  3KZC A;  3M5C A;  1P6X A;  1E2N A;  4JBX A;  1F48 A;  3L05 A;  1YVE I;  1E2J A;  3F0T A;  3FSG A;  1VTK A;  1P7C A;  3L06 A;  1GKU B; 
#chains in the KnotProt database with same CATH homology
 3L04 A;  3M5D A;  3M4N A;  3KZK A;  3L02 A;  1YH1 A;  2FG7 X;  1DBI A;  2G7M C;  3KZM A;  2FG7 C;  2XTJ A;  3KZO A;  1JS1 X;  3M4J A;  2FG6 C;  3KZN A;  1LNS A;  3KZC A;  3M5C A;  3L05 A;  3FSG A;  3L06 A;  1GKU B; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling