3FSGA

Crystal structure of alpha/beta superfamily hydrolase from oenococcus oeni psu-1
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 82-216 135 1-1, 245-267 2-81, 217-244 1 23 slipknot
Chain Sequence
MKEYLTRSNISYFSIGSGTPIIFLHGLSLDKQSTCLFFEPLSNVGQYQRIYLDLPGMGNSDPISPSTSDNVLETLIEAIEEIIGARRFILYGHSYGGYLAQAIAFHLKDQTLGVFLTCPVITADHSKRLTGKHINILEEDINPVENKEYFADFLSMNVIINNQAWHDYQNLIIPGLQKEDKTFIDQLQNNYSFTFEEKLKNINYQFPFKIMVGRNDQVVGYQEQLKLINHNENGEIVLLNRTGHNLMIDQREAVGFHFDLFLDELNS
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 24-213 190 1-23 222-267 214-221 23 46 slipknot
view details
2.1 24-241 218 1-23 250-267 242-249 23 18 slipknot
view details
2.1 91-213 123 1-29, 221-267 30-90, 214-220 29 47 slipknot
view details
2.1 88-241 154 1-61, 249-267 62-87, 242-248 61 19 slipknot
sequence length 267
structure length 267
publication title Crystal structure of alpha/beta superfamily hydrolase from Oenococcus oeni PSU-1
rcsb
molecule tags Hydrolase
molecule keywords Alpha/beta superfamily hydrolase
source organism Oenococcus oeni
total genus Genus: 83
ec nomenclature
pdb deposition date 2009-01-09
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fsgA00
3FSGA 1LNSA
chains in the KnotProt database with same CATH superfamily
1P75A 3KZOA 1F48A 2VTKA 1KI3A 1II9A 3KZCA 3L04A 3M4NA 1OF1A 1KI2A 1KI6A 3M5DA 2XTJA 1KIMA 1E2LA 1E2JA 4IVRA 3FR8A 1E2NA 1P72A 1P7CA 3L02A 1KI6B 1GKUB 1YH1A 2FG6C 3RDPA 1JS1X 3KZKA 1R4MB 1KI4A 3FR7A 4JBXA 1E2HA 1OSNA 1P73A 3FSGA 1VTKA 3M5CA 3M4JA 1KI7A 1P6XA 3KZMA 1YVEI 3VTKA 1DBIA 1E2PA 3L06A 1QMGA 1E2IA 4IVPA 1QHIA 2G7MC 1R4NB 1E2MA 3KZNA 1YRLA 3F0TA 4JBYA 2KI5A 1E2KA 4IVQA 1LNSA 1KI8A 3L05A
chains in the KnotProt database with same CATH topology
3KZOA 3KZCA 3L04A 3M4NA 3M5DA 2XTJA 1LNSA 3L02A 1GKUB 2FG6C 1YH1A 1JS1X 3KZKA 3FSGA 3M5CA 3M4JA 3KZMA 1DBIA 3L06A 2G7MC 3KZNA 3L05A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3FSG A;  1LNS A; 
#chains in the KnotProt database with same CATH topology
 1P75 A;  3KZO A;  1F48 A;  2VTK A;  1KI3 A;  1II9 A;  3KZC A;  3L04 A;  3M4N A;  1OF1 A;  1KI2 A;  1KI6 A;  3M5D A;  2XTJ A;  1KIM A;  1E2L A;  1E2J A;  4IVR A;  3FR8 A;  1E2N A;  1P72 A;  1P7C A;  3L02 A;  1KI6 B;  1GKU B;  1YH1 A;  2FG6 C;  3RDP A;  1JS1 X;  3KZK A;  1R4M B;  1KI4 A;  3FR7 A;  4JBX A;  1E2H A;  1OSN A;  1P73 A;  3FSG A;  1VTK A;  3M5C A;  3M4J A;  1KI7 A;  1P6X A;  3KZM A;  1YVE I;  3VTK A;  1DBI A;  1E2P A;  3L06 A;  1QMG A;  1E2I A;  4IVP A;  1QHI A;  2G7M C;  1R4N B;  1E2M A;  3KZN A;  1YRL A;  3F0T A;  4JBY A;  2KI5 A;  1E2K A;  4IVQ A;  1LNS A;  1KI8 A;  3L05 A; 
#chains in the KnotProt database with same CATH homology
 3KZO A;  3KZC A;  3L04 A;  3M4N A;  3M5D A;  2XTJ A;  1LNS A;  3L02 A;  1GKU B;  2FG6 C;  1YH1 A;  1JS1 X;  3KZK A;  3FSG A;  3M5C A;  3M4J A;  3KZM A;  1DBI A;  3L06 A;  2G7M C;  3KZN A;  3L05 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling