3FSGA

Crystal structure of alpha/beta superfamily hydrolase from oenococcus oeni psu-1
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 82-216 135 1-1, 245-267 2-81, 217-244 1 23 slipknot
Chain Sequence
MKEYLTRSNISYFSIGSGTPIIFLHGLSLDKQSTCLFFEPLSNVGQYQRIYLDLPGMGNSDPISPSTSDNVLETLIEAIEEIIGARRFILYGHSYGGYLAQAIAFHLKDQTLGVFLTCPVITADHSKRLTGKHINILEEDINPVENKEYFADFLSMNVIINNQAWHDYQNLIIPGLQKEDKTFIDQLQNNYSFTFEEKLKNINYQFPFKIMVGRNDQVVGYQEQLKLINHNENGEIVLLNRTGHNLMIDQREAVGFHFDLFLDELNS
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 24-213 190 1-23 222-267 214-221 23 46 slipknot
view details
2.1 24-241 218 1-23 250-267 242-249 23 18 slipknot
view details
2.1 91-213 123 1-29, 221-267 30-90, 214-220 29 47 slipknot
view details
2.1 88-241 154 1-61, 249-267 62-87, 242-248 61 19 slipknot
sequence length 267
structure length 267
publication title Crystal structure of alpha/beta superfamily hydrolase from Oenococcus oeni PSU-1
rcsb
molecule tags Hydrolase
molecule keywords Alpha/beta superfamily hydrolase
source organism Oenococcus oeni
total genus Genus: 83
ec nomenclature
pdb deposition date 2009-01-09
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fsgA00
1LNSA 3FSGA
chains in the KnotProt database with same CATH superfamily
2VTKA 3KZCA 3M5DA 1DBIA 3VTKA 1II9A 1JS1X 1F48A 3L04A 4IVPA 1KI7A 1E2PA 1YVEI 1P75A 2FG7C 1KI4A 1KI6A 1E2HA 3FSGA 3L06A 3M4NA 1P6XA 4IVRA 1YH1A 3KZMA 2FG6C 1E2MA 4JBYA 1VTKA 3KZKA 3KZOA 1QMGA 1OF1A 1P73A 1E2NA 3L02A 2FG7X 3M4JA 3FR8A 3FR7A 1KIMA 1YRLA 2XTJA 3L05A 2G7MC 1E2KA 3RDPA 1GKUB 1OSNA 3KZNA 1KI2A 1E2JA 1E2LA 1KI8A 1P7CA 1R4NB 1KI3A 4IVQA 1LNSA 2KI5A 1P72A 1R4MB 3F0TA 1KI6B 3M5CA 1QHIA 4JBXA 1E2IA
chains in the KnotProt database with same CATH topology
3KZCA 3M5DA 1DBIA 1JS1X 3L04A 2FG7C 3FSGA 3L06A 3M4NA 1YH1A 2FG6C 3KZKA 3KZOA 3L02A 3M4JA 2FG7X 2XTJA 3L05A 2G7MC 1GKUB 3KZNA 1LNSA 3M5CA 3KZMA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1LNS A;  3FSG A; 
#chains in the KnotProt database with same CATH topology
 2VTK A;  3KZC A;  3M5D A;  1DBI A;  3VTK A;  1II9 A;  1JS1 X;  1F48 A;  3L04 A;  4IVP A;  1KI7 A;  1E2P A;  1YVE I;  1P75 A;  2FG7 C;  1KI4 A;  1KI6 A;  1E2H A;  3FSG A;  3L06 A;  3M4N A;  1P6X A;  4IVR A;  1YH1 A;  3KZM A;  2FG6 C;  1E2M A;  4JBY A;  1VTK A;  3KZK A;  3KZO A;  1QMG A;  1OF1 A;  1P73 A;  1E2N A;  3L02 A;  2FG7 X;  3M4J A;  3FR8 A;  3FR7 A;  1KIM A;  1YRL A;  2XTJ A;  3L05 A;  2G7M C;  1E2K A;  3RDP A;  1GKU B;  1OSN A;  3KZN A;  1KI2 A;  1E2J A;  1E2L A;  1KI8 A;  1P7C A;  1R4N B;  1KI3 A;  4IVQ A;  1LNS A;  2KI5 A;  1P72 A;  1R4M B;  3F0T A;  1KI6 B;  3M5C A;  1QHI A;  4JBX A;  1E2I A; 
#chains in the KnotProt database with same CATH homology
 3KZC A;  3M5D A;  1DBI A;  1JS1 X;  3L04 A;  2FG7 C;  3FSG A;  3L06 A;  3M4N A;  1YH1 A;  2FG6 C;  3KZK A;  3KZO A;  3L02 A;  3M4J A;  2FG7 X;  2XTJ A;  3L05 A;  2G7M C;  1GKU B;  3KZN A;  1LNS A;  3M5C A;  3KZM A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling