2G7MC

Crystal structure of b. fragilis n-succinylornithine transcarbamylase p90e mutant complexed with carbamoyl phosphate and n-acetylnorvaline
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 174-239 66 1-173, 240-320 173 81 knot
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKEEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 173-283 111 1-172, 284-320 172 37 knot
view details
3.1 173-239 67 1-172 284-320 240-283 172 37 slipknot
view details
2.1 171-236 66 1-24, 240-320 25-170, 237-239 24 81 slipknot
view details
2.1 175-287 113 1-172, 300-320 173-174, 288-299 172 21 slipknot
view details
3.1 175-306 132 1-172, 314-320 173-174, 307-313 172 7 slipknot
view details
3.1 175-314 140 1-172, 320-320 173-174, 315-319 172 1 slipknot
view details
3.1 175-319 145 320-320 1-172 173-174 172 0 slipknot
sequence length 320
structure length 320
publication title A single mutation in the active site swaps the substrate specificity of N-acetyl-L-ornithine transcarbamylase and N-succinyl-L-ornithine transcarbamylase.
pubmed doi rcsb
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
source organism Bacteroides fragilis
total genus Genus: 114
ec nomenclature ec 2.1.3.-:
pdb deposition date 2006-02-28
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g7mC02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g7mC01
3KZCA 3M5DA 1JS1X 3L04A 2FG7C 3L06A 3M4NA 1YH1A 2FG6C 3KZKA 3KZOA 3L02A 3M4JA 2FG7X 3L05A 2G7MC 3KZNA 3M5CA 3KZMA
chains in the KnotProt database with same CATH superfamily
2VTKA 3KZCA 3M5DA 1DBIA 3VTKA 1II9A 1JS1X 1F48A 3L04A 4IVPA 1KI7A 1E2PA 1YVEI 1P75A 2FG7C 1KI4A 1KI6A 1E2HA 3FSGA 3L06A 3M4NA 1P6XA 4IVRA 1YH1A 3KZMA 2FG6C 1E2MA 4JBYA 1VTKA 3KZKA 3KZOA 1QMGA 1OF1A 1P73A 1E2NA 3L02A 2FG7X 3M4JA 3FR8A 3FR7A 1KIMA 1YRLA 2XTJA 3L05A 2G7MC 1E2KA 3RDPA 1GKUB 1OSNA 3KZNA 1KI2A 1E2JA 1E2LA 1KI8A 1P7CA 1R4NB 1KI3A 4IVQA 1LNSA 2KI5A 1P72A 1R4MB 3F0TA 1KI6B 3M5CA 1QHIA 4JBXA 1E2IA
chains in the KnotProt database with same CATH topology
3KZCA 3M5DA 1DBIA 1JS1X 3L04A 2FG7C 3FSGA 3L06A 3M4NA 1YH1A 2FG6C 3KZKA 3KZOA 3L02A 3M4JA 2FG7X 2XTJA 3L05A 2G7MC 1GKUB 3KZNA 1LNSA 3M5CA 3KZMA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3KZC A;  3M5D A;  1JS1 X;  3L04 A;  2FG7 C;  3L06 A;  3M4N A;  1YH1 A;  2FG6 C;  3KZK A;  3KZO A;  3L02 A;  3M4J A;  2FG7 X;  3L05 A;  2G7M C;  3KZN A;  3M5C A;  3KZM A; 
#chains in the KnotProt database with same CATH topology
 2VTK A;  3KZC A;  3M5D A;  1DBI A;  3VTK A;  1II9 A;  1JS1 X;  1F48 A;  3L04 A;  4IVP A;  1KI7 A;  1E2P A;  1YVE I;  1P75 A;  2FG7 C;  1KI4 A;  1KI6 A;  1E2H A;  3FSG A;  3L06 A;  3M4N A;  1P6X A;  4IVR A;  1YH1 A;  3KZM A;  2FG6 C;  1E2M A;  4JBY A;  1VTK A;  3KZK A;  3KZO A;  1QMG A;  1OF1 A;  1P73 A;  1E2N A;  3L02 A;  2FG7 X;  3M4J A;  3FR8 A;  3FR7 A;  1KIM A;  1YRL A;  2XTJ A;  3L05 A;  2G7M C;  1E2K A;  3RDP A;  1GKU B;  1OSN A;  3KZN A;  1KI2 A;  1E2J A;  1E2L A;  1KI8 A;  1P7C A;  1R4N B;  1KI3 A;  4IVQ A;  1LNS A;  2KI5 A;  1P72 A;  1R4M B;  3F0T A;  1KI6 B;  3M5C A;  1QHI A;  4JBX A;  1E2I A; 
#chains in the KnotProt database with same CATH homology
 3KZC A;  3M5D A;  1DBI A;  1JS1 X;  3L04 A;  2FG7 C;  3FSG A;  3L06 A;  3M4N A;  1YH1 A;  2FG6 C;  3KZK A;  3KZO A;  3L02 A;  3M4J A;  2FG7 X;  2XTJ A;  3L05 A;  2G7M C;  1GKU B;  3KZN A;  1LNS A;  3M5C A;  3KZM A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling